SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014996279.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014996279.1.72884
Domain Number 1 Region: 221-349
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-26
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 433-557
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-26
Family Cadherin 0.0023
Further Details:      
 
Domain Number 3 Region: 333-437
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-22
Family Cadherin 0.0021
Further Details:      
 
Domain Number 4 Region: 118-225
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-21
Family Cadherin 0.0034
Further Details:      
 
Domain Number 5 Region: 549-656
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000171
Family Cadherin 0.0035
Further Details:      
 
Domain Number 6 Region: 21-116
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000414
Family Cadherin 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014996279.1.72884
Sequence length 963
Comment PREDICTED: protocadherin alpha 5 isoform X3 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MVGWGVAVLCLWVSCGAAAGQLEYSVPEETERGVAVGNVAADLRLPAAALSSRNFRFLSS
HRELYFRVDLASGNLVVREPADRERLCRGKAACVLTYDVVLEDPLELHKIRVHVLDTNDN
SPLFPAGDVQLHIPEFLTPGARFTLPNAQDDDEGSNGILSYSLSPSQHFRLDMGSRVDGS
EYPELVLEKALDREQRATHLLVLTARDGGLPARSGDAQVTIIVVDTNDNAPVFERSVYRT
KVPETAPNGTVLFRVQALDPDEGSNGEVRYSLSNSTQAELRHRFHVHPKSGEVQVAASLG
PPETLLEAYIEARDEGVFGLASTAKLLVEVTDVNDHAPELDFMTLWNPVPEDAAPGTVIA
LFNVKDEDLGSNGRVICGMSSGGPFQLTASFDNYYSLLIDGPLDRERISEYQVLITASDS
GSPPLSTRRTITVSVADVNDNTPSFPQPQQELFVAENNGPGASLGQVFAQDPDLGKNGLV
SYELLDVISEGPPASSLVAVESSSGAITAKTSFDFEQLRGFHFQVEGRDSGIPPRSATVT
INLFVVDRNDNYPVILFPLPRNGSVPVEIVPRSARTGHLVTKVVAEDADSGSNAWLSYHI
SRASDSSLFRISANIGELRTARLVLPTDAVKQSVVVVVRDHGDPPLSSSVTLGVLLSNSV
PQLLPDFEDVWEPGGQLSAQNLYLVIALACISFLFLGCLLFFVCTKLHQSPGCCPQSCCR
STEDLRYGRKMVSNPYMTSATVDVTTVERLSQTYLYRASLGLGSDNNSLLLRGEYNAADL
RNLATGVGLNLPISCIQIRNRKGDHANVNAMPRQPNPDWRYSASLRAGMHSSVHLEEAGI
LRAGPGGPDQQWPTVSSATPEPEAGEVSPPVGAGVNSNSWTFKYGPGNPKQSGPGELPDK
FIIPGSPAIISIRQEPTNNQIDKSDFITFGKKEETKKKKKKKKGNKTQEKKEKGNSTTDN
SDQ
Download sequence
Identical sequences F7GSV5
XP_014996279.1.72884 ENSMMUP00000019133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]