SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014996282.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014996282.1.72884
Domain Number 1 Region: 239-364
Classification Level Classification E-value
Superfamily Cadherin-like 9.91e-32
Family Cadherin 0.0012
Further Details:      
 
Domain Number 2 Region: 452-578
Classification Level Classification E-value
Superfamily Cadherin-like 8.25e-29
Family Cadherin 0.0026
Further Details:      
 
Domain Number 3 Region: 353-456
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-24
Family Cadherin 0.0027
Further Details:      
 
Domain Number 4 Region: 136-243
Classification Level Classification E-value
Superfamily Cadherin-like 2.88e-22
Family Cadherin 0.0063
Further Details:      
 
Domain Number 5 Region: 568-679
Classification Level Classification E-value
Superfamily Cadherin-like 1.11e-16
Family Cadherin 0.0033
Further Details:      
 
Domain Number 6 Region: 39-118
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000614
Family Cadherin 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014996282.1.72884
Sequence length 958
Comment PREDICTED: protocadherin alpha 5 isoform X5 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MEIKQEVFDMVFTLEDRLGKQCLLLPFLLLAAWKVGSGQLHYSVPEEAKHGTFVGRIAQD
LGLELAELVPRLFRMASKNHEDLLEVNLQNGILFVNSRIDREELCGRSAECSIHLEVIVD
RPLQVFHVDVEVRDINDNPPLFPVEEQRVLIYESRLPDSVFPLEGASDADVGSNSVLTYK
LSSSEYFGLDVKINSDDSKQIGLILRKSLDREDAPAHNLFLTATDGGKPELTGTVHLLVT
VLDVNDNAPTFEQSEYEVRIFENADNGTTVIRLNASDRDEGANGAISYSFNSLVAAMVID
HFSIDRNTGEIVIRGNLDFEQVNLYKIRVDATDKGHPPMAGHCTVLVRILDKNDNVPEIT
LTSLSLPVREDAQFGTVIALISVNDLDSGVNGQVTCSLTPHVPFKLVSTFKNYYSLVLDS
ALDRENVSAYELVVTARDRGSPSLWATASVSVGVADVNDNAPAFTQSEYTVFVKENNPPG
CHIFTVSARDADAQENALVSYSLVERRVGERALSSYVSVHAESGKVYALQPLDHEEVELL
QFQVSARDAGVPPLGSNVTLQVFVLDENDNAPVLLAPRVGGTGGAVSELLPRSVGVGQVV
AKVRAVDADSGYNAWLSYELQPVASSARFPFRVGLYTGEISTTRVLDEADSPRHRLLVLV
KDHGEPTLTATATVLVSLVENGQAPKASSRMSVGAAGPEAALVNVNVYLIIAICSVSSLL
VLTLLLYTALRCSAPPAEGACTAGKSTLVCSSAVGSWSYSQQRRQRVCSGEGPPKMDLMA
FSPSLSPCPVMGRAENQALNEDHDAKPRQPNPDWRYSASLRAGMHSSVHLEEAGILRAGP
GGPDQQWPTVSSATPEPEAGEVSPPVGAGVNSNSWTFKYGPGNPKQSGPGELPDKFIIPG
SPAIISIRQEPTNNQIDKSDFITFGKKEETKKKKKKKKGNKTQEKKEKGNSTTDNSDQ
Download sequence
Identical sequences ENSMMUP00000019127 XP_014996282.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]