SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014996546.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014996546.1.72884
Domain Number 1 Region: 441-565
Classification Level Classification E-value
Superfamily Cadherin-like 5.63e-30
Family Cadherin 0.0021
Further Details:      
 
Domain Number 2 Region: 230-349
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-29
Family Cadherin 0.00047
Further Details:      
 
Domain Number 3 Region: 340-444
Classification Level Classification E-value
Superfamily Cadherin-like 6.94e-24
Family Cadherin 0.0044
Further Details:      
 
Domain Number 4 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 9.55e-21
Family Cadherin 0.0076
Further Details:      
 
Domain Number 5 Region: 556-666
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-18
Family Cadherin 0.0011
Further Details:      
 
Domain Number 6 Region: 30-124
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000271
Family Cadherin 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014996546.1.72884
Sequence length 932
Comment PREDICTED: protocadherin gamma-A6 isoform X11 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MAPLQRRPLRSEQVLLLTLLGTLWGAAAAQIRYSIPEELEKGSFVGNIAKDLELEPRELA
EHGVRIVFRGRTQLFSLNPRSGSLVTAGRIDREELCAQSPRCLVSFNILVEDKLNLYPVE
VEIVDINDNTPQFLKEELEVKILENAAPSSRFPLTEVYDPDVGINSLQGFKLSGNSHFSV
DVQSEGHGPKYPELVLEGTLDREGEAVYHLVLTALDGGDPVRSSVARILVTVVDVNDNAP
VFTQPVYRVSVPENLPVGTPVLAVNATDQDEGVHGEVTYYFVKITEKISQIFCLNVLTGE
ISTSANLDYEESRFYELGVEARDQPGLRDRAKVLITILDVNDNVPEVVVTSGSRTIAESA
PPGTVIALFQVFDRDSGLNGLVTCSIPRSLPFELEKSVSNYYRLVTNAALDREEVSLYNI
TVTATDKGTPPLSTETIISLNVADTNDNPPTFPHSSYSVYVLENNPRGASIFSVNALDPD
MDQNARVSYSLAEDTLQGAPLSSYVSINSDTGILYTLRSFDYEQLRDLQLWVTASDSGDP
PLSSNVSLSLFVLDQNDNAPEILYPAIPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQ
NAWLSYRLLKASEPGLFAVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTL
TVAVADSIPEILADLGSLEPSDGSHNSDLTLYLVVAVAVVSCVFLAFVIVLLALRLRRWH
KSRRLQALGGGLASMPGSHFVGVDGVRAFLQTYSHEVSLTADSRKSHLIFPQPNYADTLI
SQESCEKSESLLTTQDLPETKGDPRRLQQAPPNTDWRFSQAQRPGTSGSQNGDDTGTWPN
NQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGS
NATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
Download sequence
Identical sequences XP_014996546.1.72884 ENSMMUP00000028905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]