SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014996550.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014996550.1.72884
Domain Number 1 Region: 230-350
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-30
Family Cadherin 0.00025
Further Details:      
 
Domain Number 2 Region: 441-563
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-28
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 341-444
Classification Level Classification E-value
Superfamily Cadherin-like 5.85e-24
Family Cadherin 0.0018
Further Details:      
 
Domain Number 4 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-22
Family Cadherin 0.0038
Further Details:      
 
Domain Number 5 Region: 556-663
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000171
Family Cadherin 0.0021
Further Details:      
 
Domain Number 6 Region: 32-125
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000257
Family Cadherin 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014996550.1.72884
Sequence length 930
Comment PREDICTED: protocadherin gamma-B7 isoform X15 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MGGSCAQRRRAGPRQVLFPLLLPLFYPALCEPIRYSIPEELAKGSVVGNLAKDLGLSVLD
VSARKLRVSAEKLHFSVDAESGDLLVKDRIDREQICKERRRCELQLEAVVENPLNIFHII
VVIEDINDHAPQFQKDEINLEISESVSPGMGTILESAEDPDISMNSLSKYQLSPNEHFSL
VEKDNPDGGKYPELVLQKTLDRETQSAHHLVLTALDGGDPPRSGTAQIRILVIDANDNPP
VFSQDVYRVSLREDVPPGTSILRVKATDQDEGINSEITYSFLGVADKAQHVFSLDYATGN
ILTQQPLDFEEVERYTMNIEAKDRGSLSTRCKVIIEVLDENDNSPEIIITSLPDQIMEDS
PPGVVVALFKTRDRDSGENGEVRCSLSRGVPFKIHSSSNNYYKLVTDGALDREQTPEYNV
TIAATDRGKPPLSSSKTITLHITDVNDNAPVFGQSAYLVHVPENNQPGASIAQVSASDPD
FGPNGRVSYSLVASDLESRTLSSYVSVSAQNGVVFAQRAFDHEQLRAFELTLQACDQGSP
ALSANVSLRVLVGDRNDNAPRVLYPALGPDGSAVFDTVPRAAQPGYLVTKVVAVDADSGH
NAWLSYHVVHASEPGLFSLGLRTGEVRMARALGDKDSVRQRLLVAVRDGGQPPLSATAML
HLVFADSLQEVLPDFSDRPTPSDSQAEMQFYLVVALALISVLFLLAVILAIALRLRQSFS
PTAGGCFESVLCSKSGPVGPPSYNEGTLPYAYNFCVPGDQMNPEFNFVTSVDHCPATQDN
FNKDSSSMLLASILTPSLEANKILKQQAPPNTDWRFSQAQRPGTSGSQNGDDTGTWPNNQ
FDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNA
TLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
Download sequence
Identical sequences F6S226
ENSMMUP00000028910 XP_014996550.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]