SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_014999828.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014999828.1.72884
Domain Number 1 Region: 870-1170
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.05e-90
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000013
Further Details:      
 
Domain Number 2 Region: 215-359
Classification Level Classification E-value
Superfamily PH domain-like 1.63e-34
Family Third domain of FERM 0.0016
Further Details:      
 
Domain Number 3 Region: 107-213
Classification Level Classification E-value
Superfamily Second domain of FERM 9.16e-29
Family Second domain of FERM 0.00043
Further Details:      
 
Domain Number 4 Region: 21-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.27e-18
Family First domain of FERM 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014999828.1.72884
Sequence length 1174
Comment PREDICTED: tyrosine-protein phosphatase non-receptor type 21 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MPLPFGLKLKRTRRYTVSSKSCLVARIQLLNNEFVEFTLSVESTGQESLEAVAQRLELRE
VTYFSLWYYNKQNQRRWVDLEKPLKKQLDKYALEPTVYFGVVFYVPSVSQLQQEITRYQY
YLQLKKDILEGSIPCTLEQAIQLAGLAVQADFGDFDQYESQDFLQKFALFPVGWLQDEKV
LEEATQKVALLHQKYRGLAAPDAEMLYMQEVERMDGYGEESYPAKDSQGSDISIGACLEG
IFVKHKNGRHPVVFRWHDIANMSHNKSFFALELANKEETIQFQTEDMETAKYIWRLCVAR
HKFYRLNQCNLQTQTVTVNPIRRRSSSRMSLPKPQPYVMPPPPQLHYNGHYTEPYASSQD
NLFVPNQNGYYCHSQTSLDRAQIDFNGRIRNGSVYSAHSTNSLNNPQPYLQPSPMSSNPS
ITGSDVMRPDYVPSHRHSALIPPSYRPTPDYETVMKQLNRGLVHAERQSHSLRNLNIGSS
YAYSRPAALVYSQPEIREHAQLPSPPTAHCPFSLSYSFHSPSPYPYPAERRPVVGAVSVP
ELTNAQLQAQDYPAPNIMRTQVYRPPPPYPPPRPANSTPDLSRHLYISSSNPDLITRRVH
HSVQTFQEDSLPVAHSLQEVSEPLTAARHAQLHKRNSIEVAGLSHCLEGLRLKERTLSAS
AAEVVPRALSAGSQPSVFTERTKREGQEEAEGLRYGHEKSLSDATMLIHSSEEEEDEDFE
EESGARAPPGRAREPRPGLTQDPPSCPRALLAGPLHILEPKAHVPDSEKRMMDSSPVGTT
AEAQRPWRDGLLTPSMSESDLTTSGRYRARRDSLKKRPVSDLLSGKKNIVEGLPPLGGMK
KTRVDAKKIGPLKLAALNGLSLSRLPLPDEGKEVATRATNDERCKILEQRLEQGMVFTEY
ERILKKRLVDGECSTARLPENAERNRFQDVLPYDNARVELVPTKENNTGYINASHIKVSV
SGIEWDYIATQGPLQNTCQDFWQMVWEQGIAIIAMVTAEEEGGREKSFRYWPRLGSRHNT
VTYGRFKITTRFRTDSGCYATTGLKMKHLLTGQERTVWHLQYTDWPEHGCPEDLKGFLSY
LEEIQSVRRHTNSTSDPQSPNPPLLVHCSAGVGRTGVVILSEIMIACLEHNEVLDIPRVL
DMLRQQRMMLVQTLCQYTFVYRVLIQFLKSSRLI
Download sequence
Identical sequences F6X503
ENSMMUP00000012519 XP_014999828.1.72884 XP_014999829.1.72884 9544.ENSMMUP00000012519 ENSMMUP00000012519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]