SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015001181.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015001181.1.72884
Domain Number 1 Region: 556-672
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-22
Family Cadherin 0.0023
Further Details:      
 
Domain Number 2 Region: 120-235
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-21
Family Cadherin 0.00029
Further Details:      
 
Domain Number 3 Region: 333-441
Classification Level Classification E-value
Superfamily Cadherin-like 9.82e-19
Family Cadherin 0.001
Further Details:      
 
Domain Number 4 Region: 245-340
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000111
Family Cadherin 0.0014
Further Details:      
 
Domain Number 5 Region: 442-559
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000157
Family Cadherin 0.0015
Further Details:      
 
Domain Number 6 Region: 34-126
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000236
Family Cadherin 0.0043
Further Details:      
 
Domain Number 7 Region: 661-765
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000614
Family Cadherin 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015001181.1.72884
Sequence length 832
Comment PREDICTED: cadherin-17 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MILQAHLHSLCLLMLYLATGYGQEGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTF
ELTGETDNIFKIEREGLLYYTKALDRETRSTHNLQVAALDANGAIVEGPVPITIEVKDVN
DNRPTFLQSKYEGSVRQNSRPGKPFLYVNATDLDDPATPNGQLSYQIVIQLPMINNVMYF
QINNKTGGISLTREGSQELNPAKNPSYNLVISVKDMGGQSENSFSDTTSVDIIVTENIWK
APEPVEMVENSTDPHPIKITQVRWNDPGAQYSLVDKEKLPRFPFSIDQEGDIYVTQPLDR
EEKDAYVFYAVAKDEYGKPLSYPLEIHVKVQDINDNPPTCPSPVTVFEVQENERLGNSIG
ALTAHDSDEENTANSLLNYRIVEQTPKLPMDGLFLIQTYAGMLQLAKQSLKKQDTPQYNL
TIEVSDKDFKTLCFVQINVIDINDQIPIFEKSDYGNLTLAEDTNVGSTILTIQATDADEP
FTGSSKILYHVIKGDSEGRLGVDTDPHTNTGYVIIKKPLDFETAAISNIVFKAENPEPLV
FGVTYNASSFAKFTLFVTDVNEAPEFSQYVFQAKVSEDVAIGTKVGNVTAKDPEGLDISY
SLRGDTRGWLKIDHVTGEIFSVAPLDREAGSPYRVQVVATEVGGSSLSSVSQFHLILTDV
NDNPPRLAKDYMDLYFCHPLSAPGSLIFEATDDDQHLFRGPHFTFSIASESLQNDWQVSK
INGTHARLSTRHTDFEEKEYVVSIRINDGGRPPLESTVSLTVTFCSCGEDGCFRPAGHQP
GIPTVGMAVGILLTTLLVIGIILAVVFIRMKTDKGKDNVESAQASEVKPLRS
Download sequence
Identical sequences F7GJC2
9544.ENSMMUP00000026310 XP_001087601.1.72884 XP_015001181.1.72884 ENSMMUP00000026310 ENSMMUP00000026310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]