SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015003701.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015003701.1.72884
Domain Number 1 Region: 4-31
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000312
Family LASP-1 0.017
Further Details:      
 
Weak hits

Sequence:  XP_015003701.1.72884
Domain Number - Region: 32-56
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0389
Family LIM domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015003701.1.72884
Sequence length 1696
Comment PREDICTED: nebulin-related-anchoring protein isoform X4 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MNVQACSRCGYGVYPAEKISCIDQIWHKACFHCEVCKMMLSVNNFVSHQKKPYCHAHNPK
NNTFTSVYHTPLNLNVRTFPEAISGIHDQEDGEQFKSVFHWDMKSKDKEGAPNRQPLANE
RAYWTGYREGNAWCPGALPDPEIVRMAEARKSLGEEYTEDYEQPRGKGSFPAMITPAYQR
AKQANQLASQVEYKRGHDERISRFSTVADTPELLRSKAVAQLQSDVRYTEDYEEQRGKGS
FPAMITPAYQIAKRANELASDVRYHQQYQKEMRGMAGPAVGAEGMLTRECADQYGQGYLE
EYEEHRGKGSFPAMITPAYQNAKKAHELASDIKYRQDFNKMKGAAHYHSLPAQDNLVLKR
AQSVNKLVSENKYKENYQNHMRGRYEGVGMDRRTLHAMKVGSLASNVAYKADYKHDIVDY
NYPATLTPSYQTTMKLVPLKDANYRQSIDKLKYSSVTDTPQIVQAKINAQQLSHVNYRAD
YEKNKLNYTLPQDVPQLVKAKTNAKLFSEVKYKEGWEKTKGKGFEMKLDAMSLLAAKASG
ELASNIKYKEEYEKTKGKATGTADSRLLHSLQIAKMSSEVEYKKGFEESKTRFHLPMDMV
NIRHAKKAQALASDLDYRKKLHEYTVLPEDMKTQWAKKAYGLQSELQYKADLAWMKGVGW
LTEGSLNLEQAKKAGQLVSEKNYRQRVDELKFTSVTNSSQMEHAKKSQELQSGVAYKAGN
EQSVHQYTISKDEPLFLRARANAANLSEKLYKSSWENQKAKGFELRLDSLTFLAAKAKRD
LASEVKYKEDYERSRGKLIGAKGVQGDSQMSHSLQMSKLQSELEYKKGFEDTKSQCHVSL
DMVHLVHARKAQHLATDIGYKTAAHHFTALPTDMKVEWAKKAYGLQSDNQYRADVKWMKG
TGWVATGSLNVEQAKKAGELISEKKYRQHPDALKFTSIKDTPEMVQARISYTQAVDRLYR
EQGENIKHHYTPTADLPEVLLAKLNAMNISETRYKESWSKLRDGGYKLRLDALPFQAAKA
SGEIISDYKYKEAFEKMKGQMLGSRSLEDDISLAHSVYATSLQSDVNYKKGFEHSKAQFH
LPLDMAALVHAKKAQTLASDQDYKHPLPQYTSLAEDLRLSCAKKAHKLQSENLYRSDLNF
MRGVACVIPGTLEIEGRKKASELISESKYRQHPHSFKYTAVTDTPNLLHAKFSNQITNER
LYKAAGEDARHQYTMTLGLPEFIRAKTNAANLSDAKYKESWHNLRAQGYKLTIEALPFQA
ARASGDIASDFLYRHDFVKERGKLIGPQSVSDDPRIQHCRRMGQLQSELQYRRGATSSQA
QFHLPMDMVHLVHARKAQALASNHDYRTQCHEFTALPEDLKMAWAKKAHALQSELRYKSD
LVGMKGIGWLALRSPQIESAKKAGELISETKYRKKPDSIKFTTVVDSPDLVHAKNSYIHC
NERMYRSGDAESLHRYTLIPDHPDFTRARLNALHLSDKVYRNSWEQTRAGSYDFRLDAIP
FQTARASREIASDFRYKEAFLRDRGLQIGYRSIDDDPRMKHFLNVGRLQSDNEYKKDFAK
SRSQFHSRTDQPGLLQAKRSQQLASDVHYRQPLPQPTCDPEQLGLRHAQKAHQLQSDVKY
KSDLNLTRGVGWTPPGSYKVEMARRAAELANARGLGLQGAYHRRAEAVEAGDHQSGEVNP
DATEILHVKRKKALLL
Download sequence
Identical sequences F7DA37
XP_015003701.1.72884 ENSMMUP00000001624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]