SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015005231.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015005231.1.72884
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.42e-17
Family THAP domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015005231.1.72884
Sequence length 309
Comment PREDICTED: THAP domain-containing protein 7 isoform X1 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MPRHCSAAGCCTRDTRETRNRGISFHRLPKKDNPRRGLWLANCQRLDPSGQGLWDPASEY
IYFCSKHFEENCFELVGISGYHRLKEGAVPTIFESFSKLRRTTKTKGHSYPPGPPEVSRL
RRCRKRCSEGRGPTTPFSPPPPADVTCFPVEEASAPATLPASPAGRLEPGLSSPFSDLLG
PLGAQADEAGCSAQPSPERQPSPLEPRPVSPSAYMLRLPPPAGAYIQNEHSYQVGSALLW
KRRAEAALDALDKAQRQLQACKRREQRLRLRLTKLQQERAREKRAQADARQTLKEHVQDF
AMQLSSSMA
Download sequence
Identical sequences A0A2K5XUS8 A0A2K6CAZ2 G3SJI6 G7PHA3 H2QLA4 H9ZDW3
ENSPTRP00000024282 NP_001248519.1.72884 XP_001168129.1.37143 XP_003806939.1.60992 XP_004063122.1.27298 XP_005567967.2.63531 XP_011738084.1.29376 XP_011842725.1.47321 XP_015005231.1.72884 XP_016795252.1.37143 ENSPTRP00000024282 ENSGGOP00000028276 9544.ENSMMUP00000026977 9598.ENSPTRP00000024282 ENSGGOP00000028276 ENSMMUP00000026977 ENSMMUP00000026977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]