SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015006547.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015006547.1.72884
Domain Number 1 Region: 100-253
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-28
Family C-type lectin domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015006547.1.72884
Sequence length 265
Comment PREDICTED: C-type lectin domain family 12 member A isoform X1 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MSEEVTYADLKFQNSSETEKIQEIAKFGEKAPPAPSCVWRPAALFLTVLCLLMLIGLGVL
GSMFHITLKTAMKKMNKLQNINEELQRNVSLQLMSNMNSSNKIRNLSTTLQTIATRLCRE
LYSKEQEHKCKPCPRRWIWHKDSCYFLSDDVRTWQESRMACAAQNASLLKINNKNALEFI
KSRSTSYPYWLGLSPEKDYSYGTSVDDIINSSAWVTRNASDLNNMFCGYINRIYVHYDYC
IYRKKMICEKMANPVQLGFIHFREA
Download sequence
Identical sequences 9544.ENSMMUP00000003951 ENSMMUP00000003951 XP_015006546.1.72884 XP_015006547.1.72884 ENSMMUP00000003951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]