SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015006617.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015006617.1.72884
Domain Number 1 Region: 166-362
Classification Level Classification E-value
Superfamily E set domains 1.31e-73
Family Cytoplasmic domain of inward rectifier potassium channel 0.000002
Further Details:      
 
Domain Number 2 Region: 49-181
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.69e-22
Family Voltage-gated potassium channels 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015006617.1.72884
Sequence length 424
Comment PREDICTED: ATP-sensitive inward rectifier potassium channel 8 isoform X1 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MLARKSIIPEEYVLARIAAENLRKPRIRDRLPKARFIAKSGACNLAHKNIREQGRFLQDI
FTTLVDLKWRHTLVIFTMSFLCSWLLFAIMWWLVAFAHGDIYAYMEKSGMEKSSLESTVC
VTNVRSFTSAFLFSIEVQVTIGFGGRMMTEECPLAITVLILQNIVGLIINAVMLGCIFMK
TAQAHRRAETLIFSRHAVIAVRNGKLCFMFRVGDLRKSMIISASVRIQVVKKTTTPEGEV
VPIHQLDIPVDNPIESNNIFLVAPLIICHVIDKRSPLYDISATDLANQDLEVIVILEGVV
ETTGITTQARTSYIAEEIQWGHRFVSIVTEEEGVYSVDYSKFGNTVKVAAPRCSARELDE
KPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPKVQFMTPEGNQN
TSES
Download sequence
Identical sequences A0A096MT83 A0A2K5KTE8 A0A2K5XP45 A0A2K6BSQ1 F7H7S9 G8F4D1
NP_001182588.1.72884 XP_005570403.1.63531 XP_005570404.1.63531 XP_011757306.1.29376 XP_011825261.1.47321 XP_011913737.1.92194 XP_011913738.1.92194 XP_015006615.1.72884 XP_015006617.1.72884 ENSPANP00000003011 ENSMMUP00000027387 9544.ENSMMUP00000027387 ENSMMUP00000027387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]