SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015008177.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015008177.1.72884
Domain Number 1 Region: 260-431
Classification Level Classification E-value
Superfamily Fic-like 1.29e-50
Family Fic-like 0.0027
Further Details:      
 
Domain Number 2 Region: 106-178
Classification Level Classification E-value
Superfamily TPR-like 0.00000000506
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015008177.1.72884
Sequence length 460
Comment PREDICTED: adenosine monophosphate-protein transferase FICD [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MMLMPMASVMAVTEPKWVSVWGRFLWVTLLSMVLGSLLALLLPLGAVEEQCLAVLKGFYL
LRSKLDRAQHAAAKCSSPSTELSITSRGVTLLVAKTKASPAGKLEARAALNQALEMKRQG
KREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVSR
DRTLPLVEEIDQRYFSIIDSKVKKIMSIPKGNSALRRVMEETYYHHIYHTVAIEGNTLTL
SEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRVLGY
VDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEDAMNLHPVEFAALAHYKLV
YIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSEYYHVLEAANEGDVRPFIRFIAK
CTETTLDTLLFATTEYSVALPEAQPNHSGFKETLPVKPSP
Download sequence
Identical sequences A0A0D9S2R6 A0A2K5ZK84 A0A2K6C7F8 G7MXM0 G7PI52
9544.ENSMMUP00000022529 ENSMMUP00000022529 ENSMMUP00000022529 XP_001095158.2.72884 XP_005572197.1.63531 XP_005572198.1.63531 XP_005572199.1.63531 XP_008002767.1.81039 XP_008002768.1.81039 XP_011716699.1.29376 XP_011716700.1.29376 XP_011716701.1.29376 XP_011716702.1.29376 XP_011716703.1.29376 XP_011830949.1.47321 XP_015008176.1.72884 XP_015008177.1.72884 XP_015008178.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]