SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015010202.1.56816 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015010202.1.56816
Domain Number 1 Region: 614-673
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.44e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 138-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000572
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 3 Region: 338-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000339
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 4 Region: 667-724
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000457
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 531-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000909
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 6 Region: 472-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000984
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number 7 Region: 585-639
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000258
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Weak hits

Sequence:  XP_015010202.1.56816
Domain Number - Region: 421-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000118
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number - Region: 1254-1280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00499
Family Classic zinc finger, C2H2 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015010202.1.56816
Sequence length 1281
Comment uncharacterized protein Dere_GG21197, isoform B [Drosophila erecta]; AA=GCF_000005135.1; RF=representative genome; TAX=7220; STAX=7220; NAME=Drosophila erecta; strain=TSC#14021-0224.01; AL=Scaffold; RT=Major
Sequence
MNNQRYGGIQWIQHHVSAGDSSEVDILESDGGAGASGEDLDHMAAENLIFMARDGQLSEI
MAANEAGRTVLVTADGTTVAYAESFDDDAQVVTEEVITDDWVQHQGAERVEIAAEQIAGI
SSSQELLDMEQDEYTALRPYPCDFCSRRFRKKVTLNTHMLAHQNDRPHLCKLCGARFSRR
AELISHFKAHAEAQDAADAEAAAAATDSSSAIKFEHQTQRQMDDHYYEQDWPLFQQQQEQ
EQAQQEIHQQHQIVEEGEVQLVASYPATVDPPAAPSRGRISRLKPKEESSQFIEISKSAG
DSRSYMEPEPAQPVVTTSQPIAIDPPPQPNFPVLDDSKPFVCQQCGLAFAREKAFVSHTK
NHRVDSLFECNQCQEMFWDNNSLQEHQKTHQFEESNSEYDPASAEDSGSESEPDEQLYGE
FYCNECGISFHRQDLLRRHAKLHYKPTEQAAGGSNSDVTAGGDEEHAKDSTGHCCNTCGK
SFPSALEMLAHAEIHARFPPFKCVLCGISFYEEQAIKRHLHTRHPSELKANSCVLCGKEC
RDRKALIKHAWDHSREKCHSCSKCGKNFHNKARLKRHMASHRDKSVVCEVCQEEFPDGRT
LSNHRHSHSTTSPGKLFPCHECGKTFGSRSSQQIHVRIHTGERPYGCRYCWKAFADGGTL
RKHERIHTGEKPYACSVCPRAFNQRVVLREHIRSHHSGLDVTRNTYHCTVCSEDLLTSND
LIQHLIQHSDSNTAKQRQPVTGPRKYKRRRKLQPHEIAHMRAENRDANGEEEEAVGEGDA
EEYASDIDLCDFDVENVDDIFDMAESPKKEKRKRGSAATKADPKPVNNGKAVKPPQERGN
AKPRYDSTSSQQSDRIWEEKFLHDSQVALFQIDSLVVVNDTHLQPASSAVSSNIPNTRGG
SKQQGKVQAKSVEGAGNFNSSATTSVSSVSATTSTSSSRSRRRAATTKTASKAPPASNSR
PRMIHTEKAKVSRGAGGDSSSSSAKKTRSKTYISRTESNNLSLDKTRSSASNMVDDYEII
SPATHPPNQISSSPLHIKQEQEQQQRVQLMYDDNLLIDAAMLREKTYEKFNPSIVNDLEE
ILRSPLKHERNSRLRFTSESSTTPQYLPEEEQNLIKIEPTSPDLREMLESQQRVTAHSTS
TPSSSSSARTSRHLRQITANGARAGSKRSPGGVASKSSANSGVVAKKANTATKVSSSSSS
YLSYGVDSYNVNVPASANNADVGGGFFSISEVVSAADAADAAAKAAAAGKSERKTRSFEC
EMCSAIFYDRAQLLEHVHIHI
Download sequence
Identical sequences B3P3L3
FBpp0139743 XP_001979943.1.56816 XP_015010202.1.56816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]