SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015013372.1.56816 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015013372.1.56816
Domain Number 1 Region: 15-177
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.44e-63
Family A middle domain of Talin 1 0.0000401
Further Details:      
 
Domain Number 2 Region: 186-308
Classification Level Classification E-value
Superfamily I/LWEQ domain 9.42e-52
Family I/LWEQ domain 0.0000756
Further Details:      
 
Domain Number 3 Region: 1807-1998
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.57e-50
Family I/LWEQ domain 0.00014
Further Details:      
 
Domain Number 4 Region: 278-414
Classification Level Classification E-value
Superfamily I/LWEQ domain 9.02e-44
Family I/LWEQ domain 0.00017
Further Details:      
 
Domain Number 5 Region: 743-879
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.77e-34
Family VBS domain 0.014
Further Details:      
 
Domain Number 6 Region: 1359-1490
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 6.75e-34
Family VBS domain 0.00038
Further Details:      
 
Domain Number 7 Region: 601-726
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000267
Family alpha-catenin/vinculin 0.039
Further Details:      
 
Domain Number 8 Region: 470-570
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000608
Family I/LWEQ domain 0.0045
Further Details:      
 
Domain Number 9 Region: 1525-1649
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000124
Family VBS domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015013372.1.56816
Sequence length 2344
Comment uncharacterized protein Dere_GG14324, isoform C [Drosophila erecta]; AA=GCF_000005135.1; RF=representative genome; TAX=7220; STAX=7220; NAME=Drosophila erecta; strain=TSC#14021-0224.01; AL=Scaffold; RT=Major
Sequence
MFYKTKEVRISSVNLTEPQRALIGYISAGQDVLIRADEELRTKAPIQELGSDLRSIEWRE
NTLDTSKQAVSSHVATMSAATAQIITASHPDEVDTEAISASVSQIAQTIPEVTKEVRLIA
ALMENDKNGAHLLEAARNLCNAFSDLLKAAEPESKEPPQHLINAASRVGEATTHVLSTIA
EEEVPENRDLHDMLLALAKAVANTTAALVLRAKNIAASCEDEQARNRVIGAASQCALATS
QLVACAKVVAPTLHNAACREQLEAAAKNVARAVNSLCEVCNEASNDPKLKADLLAAARDV
SKSLTDMLEHVKLSSREHANRTSTELSPVENVIIGTDILVSTHDPQEMVRHARTLGQTTA
QLIQSIKGEADQQQDADMKRHLLSAAKQLADATAKLVEAARLCSSNPHDSDNQNALRKAA
EELREITTTAANTPAMKRGLIQRLEFCSKQAASAATQCISAAQNAVQHSQDHQTKETLLQ
DCKRVADTIPRLVTSLKTTRAQPDDPNAQLNLIEAAEQFIEPALQVSKSSRALQPTVTDI
PSATQLSKGALHLGQCVSELHSVAQRARDACGGQELESALEEVRKLHDVLDDTRQAAIAG
QLRPLPGQTVENTADELRKSAKNVGIALSQLLSSVLHNQRSYAGAAGRDTALALGDFTRS
VHGVAATTQNPTIIDCADDVVTSSARLIEQAQRTLQGACNPEALTQAGREVTGALSATVD
CIPGQREVDVALRNVSDLSEILSMSEFPPSSRPYATLQSELKQVAEQLSSAGGEIVVSYS
SPALLAESSQNFAANYRDLLSVSMEMAGQTQEEEIRSHMIESLRHVSTQSCSLLSTAKSI
AADPGQPNAKNLLHAAARGVTESINQLVDASIQSAPGQKECDNAMRNIEALRLMLDYPHE
PINELGYFDCVEQATGKSRNLGYAISEMINNAKQSQHVEFSQSVNNVNDSIQGLIESSSQ
AAYLIGVSHPSSVAGRPGIIDQAQLTWAYQGIRQHCDIVSSQQSTKPQMISALTVIAKHT
SYLCSICRQASMNTSNPVAKNEFIVLAKQVATATSDLVQSIKAIEEQPSGGSRERLVDPL
LEAVKAVRQYASSPEFSSVPAKISAEGRKAQEPVIQAGRGVIDGVVEMVKAAKSLALTPD
NPPVWQQLSMHSTPVSESVKRLVDNIRDKAPGQAQCEQVLHTLGTCTRELDSCALAVNAQ
GLSQRRDNNLHGFSGQTMNSASELIDKLEPIRVAGKNNAEQLGHAVGEISRYVVPMVNGA
IGACTHIVHSQQQMSLIQQTRSVVESAITLVQSAKDSAGNPRATQAHPRLDDAIDGTREA
IQELQQTVEKINAETGIVTGLMEQVNRSISRLTDKRQSLLNASYSDTFVDYQTRMVARAK
EIASLANEMNAKSSVEPSVLPQLAVDMTQNYQQLTQDSVGASTTTSSPDVAMRIRTTVID
LGRSVSSMIQSSAGGARPNDVGAQKEIARSAREVSEKVAQVLAALQAGSRGTQACINAAH
TVSGIIGDLDTTIMFATAGTLHSDGDGSFADHREHILQTAKALVEDTKVLVTGAAGTQDQ
LANAAQNAVSTITQLAEAVKRGACSLGSTQPDSQVMVINAVKDVASALGDLINCTKLASG
KSINDPSMQDLKESARVMVLNVSSLLKTVKAVEDEHTRGTRAMEATVEAISQEIRAMHTP
PPVGNTQVGPEDLIRVTMNVTAATAKAVAAGTSNLQADIVSAANLGRRAISDMLIVCRSV
AWNCAETEELRARTLEAGTAVGESYRELLSGILHNCSADDRMHLSRRVAKCVTDLVGMAR
LLKGSDWIDPEDPTVIAENELLGAAASIDAAAKKLASLRPRRQADVKIELDENMKFDEMI
LEAAKGIMGASAALVRAANAAQRELIDTGKVARRPLTSSDDGQWSEGLISAARLVAAATH
SLVEAAQNLVRGVATEETLISTAKQVAASTAQLLIACKVKSNPNSEAGRRLQAAGNAVIK
STDNLVRSAQQGLEAEEERFITINTSMVDGMAQEINARSAVLRKEKELEEARQRLKNVRH
AQRFAKNAQGFTTDESDTEYANRSQNNTLGRSGYYGSSEMPSSPSYLSGGQQQKHHYNNT
SPRPQHFHHPGAVSPPPSNYPPMDDPSGDFPPPPPPLSTTISNMQTATSGHSFRPNPKLT
ANAVPRPYPGSPGGSNGLIPAPTTSGTPTNTNYQQSYESSSIKTLNSSPPAVPKKPTANR
NLAACVQDLHDKTFGQGGVVQLTGGNGYPGQNYEGYTSRYETRNFDKSANNTTSSSSELG
AVKPLESSFSQMTLNTDGGKISIVDQGSERLTSMTQRVMERKSFTTTTESRSETKTEKHS
FRLD
Download sequence
Identical sequences A0A0Q5U5E1
XP_015013372.1.56816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]