SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015017753.1.58863 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015017753.1.58863
Domain Number 1 Region: 368-591
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-54
Family DBL homology domain (DH-domain) 0.00017
Further Details:      
 
Domain Number 2 Region: 71-186
Classification Level Classification E-value
Superfamily BRCT domain 9.16e-20
Family DNA topoisomerase II binding protein 1, TopBP1 0.061
Further Details:      
 
Domain Number 3 Region: 203-282
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000000567
Family DNA topoisomerase II binding protein 1, TopBP1 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015017753.1.58863
Sequence length 851
Comment uncharacterized protein Dmoj_GI12189, isoform B [Drosophila mojavensis]; AA=GCF_000005175.2; RF=representative genome; TAX=7230; STAX=7230; NAME=Drosophila mojavensis; strain=TSC#15081-1352.22; AL=Scaffold; RT=Major
Sequence
METIEEQSKTEMSIMSKLPTRICLVGEAGRDAETLQAAESFGMPVIQSETGLDIINDTDW
RTFYVLQDFEDEIFDAIHKQKECILGPPALKYAAEMKQTLGQNTRPIYNYAMRGVVTCFT
GIRKKDELTKLVNLIHSMGGCIKKDLNTKTTHLICNHSGGEKYQYAKTFRLTVVRPAWVY
AAWSARNSLGFEATQDNFTKAHRLKAFEGQKICFFGFPAEEHQHMVDVLLENGGVCAELD
DPECSHVVVDEHTTVSKPEPKNHNTHILKSDWFWYTIQNGYANEMDYLFGDYLDSITNTP
STDRRDSLPISFNKRKRKRFSQRIQLEGTPLGSGKRRSSVSDAGLLSVSNSFFDCTTSPD
KLENDKLLHVEPEVSEATPTKKSMRFNHFMDFFTTESNYVGILDTILNLFKNKLEELAET
NDPLLNKSEIKSIFGNFLPIHEVHQSMLEHLRKLHANWREDCLIGDIIIQHRDDLIKAYP
PYVNFYEQMKEQLQYCDREYPRFHAFLKINQTKPECGRQSLQDLMIRPVQRLPSISLLLN
DILKHTANSNADHARLEEALKAIKQVTLHINEDKRRTESRMAIFDIFNDIDGCPAHLVSS
NRSFISKCEVNELSDSLSGRGDILLLYLFSDSIELCKRRSRGFNTAKSPSTAKTHKHIKL
ISLNTIRFVIDVTDSPRAFGLLQRGEKEKLYTFSIIDEETDKLVYLKKLCMQIAAHTCRT
DADKMLLSRTSLELEVDISDVNVSTLSKAFKLAAKTRLKVGRAFSFNKTPNKLKRAVSTM
MTSPFGSTNSLTPASQLAQMRLASCTNINEVADEDCASMRSNSPSTQSELLVVPPLSVQP
TRKNKAVVGRI
Download sequence
Identical sequences A0A0Q9XCU3
XP_015017753.1.58863 XP_017864113.1.65068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]