SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015024130.1.90633 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015024130.1.90633
Domain Number 1 Region: 94-543
Classification Level Classification E-value
Superfamily Sema domain 5.62e-132
Family Sema domain 0.000056
Further Details:      
 
Domain Number 2 Region: 1413-1542,1734-1895
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.26e-43
Family p120GAP domain-like 0.047
Further Details:      
 
Domain Number 3 Region: 905-1001
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000117
Family Other IPT/TIG domains 0.0093
Further Details:      
 
Domain Number 4 Region: 998-1086
Classification Level Classification E-value
Superfamily E set domains 0.00000000000255
Family Other IPT/TIG domains 0.081
Further Details:      
 
Domain Number 5 Region: 546-597
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000628
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 1105-1187
Classification Level Classification E-value
Superfamily E set domains 0.000000042
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015024130.1.90633
Sequence length 1952
Comment uncharacterized protein Dvir_GJ20569, isoform B [Drosophila virilis]; AA=GCF_000005245.1; RF=representative genome; TAX=7244; STAX=7244; NAME=Drosophila virilis; strain=TSC#15010-1051.87; AL=Scaffold; RT=Major
Sequence
MNMLCILCLLSITILGNLPSRSAHGQILHLYKKSNEQLNSGFTYAQPSVLDVRADRIGRS
AEALRVNITETDPNVLTRNAGNFSTNIITNVAKFDTRLNHLLVDTVTGRVFVGGVNRLYQ
LSPDLELHETVKTGPQNDSVECTILDCPLNAVRKPTDNYNKVLLIDRATSRLIACGSLFQ
GTCTVRNLQNVSIVEHEVPDAVVANDANSSTVAFIAPGPPQHPVTNVMYVGVTYTNNSPY
RSEIPAVASRSLEKTKMFQIASSAVTTGTRTFINSYARETYLVNYVYGFSSERFSYFLTT
QLKHSHHSSPKEYITKLVRICQEDSNYYSYTEIPVECISEAQGGTKFNLVQAGFLGKPSS
DLAQSLGISIQDDVLFAVFSKGESNTPTNNSALCIYSLKSIRRKFMQNIKFCFNGNGMRG
LDFISPSMPCVLTKLQTIGEDFCGLDVNSPLGGEQPITAVPVAMFNTRVTSVAATSTSGY
TVVFIGTVDGYIKKVVVESATVANEYASLAVDLGSAINQDMQFDNQNLYVYAMSERKVSK
VKVYDCADFRTCGECLGAKDPYCGWCSLENKCSPRSNCQDDANDPLYWVSYKTGKCTTIT
SVVPHQLQRTTARTLELIIDHLPQLKENLICAFTTEDKALFTNATKKRNGVNCTTPRTDM
LPQIEQGKHHFTAKLSVRTRNGPDLVSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRC
THDTAENCRNDILVTGVSRIGPSYRSGPGFCPTINATGDGSEVLVAAGTSKSIKVKVHII
GQFIVQTRFVCQFNIEGRVTSLNAQLLGDTIYCDSMEFQYTSRSPNLTATFAVIWGGSKP
LDNPHNIHVVIYRCRVMADSCGICLALAEKYNCGWCSSTNTCEVVEQCNKNNEGKTDWLN
RSEICPNPEIHSFGPKTGPWEGGTNITIKGINLGKNYNDIYSGVRIAGINCMPFQQFYID
TKQIVCTVDSPGEQMYRNGRIVVQIGDYRGESKEDYEFVDPKISNFYPRFGPSSGGTQIR
IIGKHLNAGSRIQAFINDHLPCKIISTDSSQAICQTSPSPGIIEGRLKMSFDNGPREFND
YNFKYVLDPTVEQVSSGPSGQIKVPKGIPAGGIRIIVTGTQFTSIQAPSIYVFYKGQMYA
SQCRVQSDNEMECPSPTIEADSQILDPENPTLLEYGFLMDNVLKVQNLSKKHNNHFELYP
NPEYFTFEERVKYFKSEYLTINGRNLDRACKETDVEVKIGNGYCNITSLSRQQLTCRPPT
EAVAASNSPNGPEVIVRIGSSLEYRIGILSYESSNLIMDWGDNVVFVVIAGCVIFFLIFC
ALLVAYRKKTAESHRELRNMQEQMDILELRVAAECKEAFAELQTEMTDLTGDLTSGGIPF
LDYRSYAMKILFPNHEDHVVLQWERPELLRKEKGLRLFAQLIMNKTFLLLFIRTLESNRY
FSMRERVNVASLIMVTLQSKLEYCTDILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEKM
LSAWFTFLLYKFLKECAGEPLYMLFRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDF
RPMTVNASIIQQPIFCNNLDMLPSHTENVSVKVLDCDTIGQVKEKCLETIYRNIPSSQRP
RKDDLDLEWRTGATGRVILYDEDATSKTENDWKKLNTLQHYNVPDGAGLSLVPKQSSIYN
FSILSDKNEKSHNRAGSPLNNDMHENGMKYWHLVKHHDSDIQKEGERVNKLVSEIYLTRL
LATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDDQALLHGITDPEVVHTWKSN
SLPLRFWVNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYA
KDIPEYRKWVDRYYRDIRDMSSISDQDMNAMLAEESRLHTTEFNTNCALHELYTYAVKYN
EQLTVTLEEDEFSQKQRLAFKLEQVHNIMSAE
Download sequence
Identical sequences A0A0Q9WWG1
XP_015024130.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]