SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015030494.1.90633 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015030494.1.90633
Domain Number 1 Region: 127-187
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000157
Family Tachycitin 0.0075
Further Details:      
 
Domain Number 2 Region: 21-84
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000228
Family Tachycitin 0.032
Further Details:      
 
Domain Number 3 Region: 191-248
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000228
Family Tachycitin 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015030494.1.90633
Sequence length 252
Comment uncharacterized protein Dvir_GJ11448, isoform B [Drosophila virilis]; AA=GCF_000005245.1; RF=representative genome; TAX=7244; STAX=7244; NAME=Drosophila virilis; strain=TSC#15010-1051.87; AL=Scaffold; RT=Major
Sequence
MFKSSLLFALVFIFWPHVNADTFEECSDADAESFVSSYESCQAYVYCDGDDSILGQCDDG
QYFDPESGTCDDAANVSCFLDEVDEPPVEEQPEEPAVQPTEEPEPTPPTMETPAQVEVVN
VAPIVKPSCPQSDDPSQVIFMANNESCTDYYLCYHGHAMQMQCTNQLHFNPITGQCDYPE
NVHCALDEPAAHKCLPHMTDFFPHPDKCSYFYYCIKGFLTLQQCPFYYGWDIERRSCVQL
NVAKCYGSSRRA
Download sequence
Identical sequences A0A0Q9WVN2
7244.FBpp0225865 XP_015030494.1.90633 FBpp0225865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]