SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015046027.1.41174 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015046027.1.41174
Domain Number 1 Region: 906-932
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000000235
Family Ran binding protein zinc finger-like 0.00097
Further Details:      
 
Domain Number 2 Region: 1009-1036
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000153
Family Ran binding protein zinc finger-like 0.0015
Further Details:      
 
Domain Number 3 Region: 1066-1091
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000327
Family Ran binding protein zinc finger-like 0.0013
Further Details:      
 
Domain Number 4 Region: 965-990
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000034
Family Ran binding protein zinc finger-like 0.0012
Further Details:      
 
Domain Number 5 Region: 1122-1148
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000102
Family Ran binding protein zinc finger-like 0.0018
Further Details:      
 
Domain Number 6 Region: 1234-1261
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000144
Family Ran binding protein zinc finger-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015046027.1.41174
Sequence length 2121
Comment uncharacterized protein Dyak_GE17279, isoform F [Drosophila yakuba]; AA=GCF_000005975.2; RF=representative genome; TAX=7245; STAX=7245; NAME=Drosophila yakuba; strain=Tai18E2; AL=Chromosome; RT=Major
Sequence
MEDGQEQRESSQAELAKLHPLTPLKELPEEGEEEEDESSAGALQSGNNNSIMGKMKMRVS
SILPASLSGWFSPSSKGGPEALSSPANVRQSQPRQSNGRSTTKRKRGRRRIMLAEADADA
ADDLDDGSDAKGLNYEEVALADNIAEHDLAAEDEQTRRSEYNVFLLRKRAGAVAAAGGDE
DEAEEDELEEDDDEGDEEDDDEEQENLLQSAAVQPKRRRLELETTVNLPNMRRLPLLSST
PAAPLAAATTSSTSQMYKSGSQLAPHRRNHLNLYSSQRQREPAYNFFTGNEAAEGSTGDL
PHSIRRSLNIPFGGSSNATSHNSLSSLPNHKRPSLIGQRTHRRDLTMDETGIGLAISSED
HINHLLRISRTNNNTSNNNNNNNNVIKSKSRRTELSVAAGAGGDSQSESDMNEYHNNGEG
HDGLRPAHHNSNSNLEFYGNLQSSKSIFNRSSSAAQPSHRNSTWSLNSLNQRRRFNASIY
GSTSALSDSRLLSRSASNSGSASASSSPFYQGRTTFGGNSANNRIFSRSNLSSSAASSTL
ALNSAGSSPAHPLQGSLTGGIGYGMKPVDMRPSDSASHSETSVGQGGSKNPGSGLSNTTL
RILNLLDSYSTPLIDAKRMGSTLKEHQSSRQLRQGTSATPYSCNMMGRRNVPAPTLANEL
AELRSNKLLVPTMQQLLERRRLHRVTQNSRDVVHSQNIRVRAENNQEKPKQPVPYVAPID
QPASHSHHTNKMRSRLSHQTRNKEPRTEQEEAPPPLDLPQISFPDMASAPKFDLVIKPTV
PVVSKPSSTVPIPSSKSSSSNLSTTNSKQLQNFLANPQPAAPIVNFSANGNVSAISKPTG
RTFTFSAPKPLTHLQENCIAKPKISRKYTFPAPASLDDVITTKQSQPTINGTPSLGFGEQ
FKKSSKEWECDACMVRNKPEANKCVACETAKPGASAASAQAPPPTAAIVAQSFGGFGDRF
KKSTTAWDCDACMLSNKAEASKCIACETPRKTAAPKVNSFTPLITNAKSNEWECSVCLVR
NKVEVSKCVACESAKPPAAPTFGNLGVVPPLMATDGFGDRFKKSSAAWECDACMLSNKAE
ASKCIACETPRKSAAPTVNNFPSINNNLSAVSGFGMASKPRANTWECQSCLVMNKSGVAE
CVACQTPNSQARSNNSESARSPSSCFSSTSSSVSSSGSSSGSSSGSSSGSVASGSIVSIS
STSESSIYGFKPGQASKVPQQDAAFQQLVAAQKTASWDCDACMAQNDMSRTSCICCEQLK
PGASSLAAISTTISSGSGSSGTANSAAISVPKFSFGFATVKEVVKPTVETTTAAPPSTQF
SFGFGQSNQGKDVADSKNTEAPRIFSFGVSKVEPKTVSFKTITKETTATSSSEATAPAAA
PALSFEFKAPTTATTASSITTTTSTTSTTPALGGFSFGAPSSSSTVSSSTASSSANPTAV
KPMFSFSGAGSAVSSTSSQQPAAKAPTLSVGVSSSTVTTTTTSTTALAFTPASTPAPAAA
TTAPAPGGGFSFGSQSKPASTPGTGTFFFGQTTAAAPATPTNSSVSSIFGEAVSTTTNSS
SSVSATTSTTNAIAPSFASTSTPQVFGNWGESKTETTTSSAAKPFTFGASSGSETTATSS
FGWSSNGAAAKSNSIAVTSAAVPSTSASTMANPIFGSSSMFGLSSSNTTSTTSLPFGSTA
TTTTAATPAAGSLGGNGALSAVFGNVGNSLVPAGTPAATTPAATAAAPLASIFGNPTPIA
AAAPVFGSGSTITSGGFGAAAAATAVPGAFNFGGATAATPAASSAPYKFGSSTNEPLAKP
AFNFTGSAASSTAPAPTFNFSANTAATNLSSGDQSQPRIFQFGGPQPAASNPASGVGGAS
NSSAGGMPMFNFAAGAPQMQLQSASRRQFGAEFPDGSPQNPRSRAPSAAPVEMASQSAIK
IANACTEAAVGLGLGLWVPVGRTARAVEASGVDGEKQNTRDTGGNSRIKGAVHRQNRQEL
DFQGLSKMFKDNRQPPSLNKYRFVRRDSRHAKTEADSSIGIKGRNIGEQNPAREEGVGYH
VSQFTFKPIPQWTTQNESNGGDVLTCTPTTGDQEDNQTGVQALESRSQERIVVRSQYKIV
RRRSDSWTPNHKPPSDSQNPY
Download sequence
Identical sequences A0A0R1EED7
XP_015046024.1.41174 XP_015046027.1.41174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]