SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015046584.1.41174 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015046584.1.41174
Domain Number 1 Region: 13-132
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.36e-32
Family Calponin-homology domain, CH-domain 0.0000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015046584.1.41174
Sequence length 495
Comment uncharacterized protein Dyak_GE15400, isoform B [Drosophila yakuba]; AA=GCF_000005975.2; RF=representative genome; TAX=7245; STAX=7245; NAME=Drosophila yakuba; strain=Tai18E2; AL=Chromosome; RT=Major
Sequence
MAPSVPSNVTVASNVTVTHNSMVQWSRGDILEWFNDTLKCSLTKIEHLCTGAAYCNLMHM
LFPDVINLKRVKFVSNQEYEFLANFKELQKAFNMVEVSPPVQVNKLVKGRCVDNFEFAVW
FRHFFVSNHNAERLKGYDVLASRDHQDIGLGSSRSTTPVSATKNRRGIEIVKISPRRGQK
KAAYEDYIETNQNKSPAFKKDDRKQGSTTAEAPVLKPKPGKFPLNQSNTKDKTTKAAMPA
KEPTRFSKRSVRIPPLDLTGICADTPRPMTPAMGTKSTEKPGRQNGTGRTGPTMIQTRKP
SVQNASEPKKKEAAKRIEAVNERIHRPEPEKRSHECKPEKNGPRMEQLGVGKEKESLHKT
NPNENPAKPSNNEKTNNQNNNTQYIHSEIIEIFKSPVYFTEKGSKPKTHDDDSDNDDDDD
DGAIPVELSKNLAKLLTSCELSKEQLLAEVMIHCGLHLYIKNTDDDDDDDVDTAVQTTST
DAASGSQTGKAAKHL
Download sequence
Identical sequences B4PXH9
FBpp0260410 7245.FBpp0260410 XP_002101822.1.41174 XP_015046584.1.41174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]