SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015049543.1.41174 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015049543.1.41174
Domain Number 1 Region: 507-669
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 4.18e-64
Family A middle domain of Talin 1 0.0000401
Further Details:      
 
Domain Number 2 Region: 678-800
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.55e-51
Family I/LWEQ domain 0.0000769
Further Details:      
 
Domain Number 3 Region: 2299-2491
Classification Level Classification E-value
Superfamily I/LWEQ domain 3.27e-50
Family I/LWEQ domain 0.00013
Further Details:      
 
Domain Number 4 Region: 770-906
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.12e-43
Family I/LWEQ domain 0.00017
Further Details:      
 
Domain Number 5 Region: 1235-1371
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.53e-34
Family VBS domain 0.015
Further Details:      
 
Domain Number 6 Region: 1851-1982
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.65e-34
Family VBS domain 0.00036
Further Details:      
 
Domain Number 7 Region: 203-317
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-29
Family Second domain of FERM 0.00000936
Further Details:      
 
Domain Number 8 Region: 318-408
Classification Level Classification E-value
Superfamily PH domain-like 2.03e-25
Family Third domain of FERM 0.0000575
Further Details:      
 
Domain Number 9 Region: 1093-1218
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000148
Family alpha-catenin/vinculin 0.028
Further Details:      
 
Domain Number 10 Region: 962-1062
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000589
Family I/LWEQ domain 0.0043
Further Details:      
 
Domain Number 11 Region: 2017-2141
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000204
Family VBS domain 0.013
Further Details:      
 
Weak hits

Sequence:  XP_015049543.1.41174
Domain Number - Region: 1479-1563
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000432
Family I/LWEQ domain 0.0075
Further Details:      
 
Domain Number - Region: 82-134
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000583
Family Ubiquitin-related 0.056
Further Details:      
 
Domain Number - Region: 1591-1665
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0022
Family alpha-catenin/vinculin 0.085
Further Details:      
 
Domain Number - Region: 1711-1806
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00282
Family alpha-catenin/vinculin 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015049543.1.41174
Sequence length 2836
Comment uncharacterized protein Dyak_GE20752, isoform D [Drosophila yakuba]; AA=GCF_000005975.2; RF=representative genome; TAX=7245; STAX=7245; NAME=Drosophila yakuba; strain=Tai18E2; AL=Chromosome; RT=Major
Sequence
MSTLSLRIQLEGGRVTKTIQFQPNTTVFDACKVIRDKFAEAVQGQPSEYGLFISDEQNQQ
GVWLEPGRTLGYYILHNQDTLEYRRKTRTLRVRMLDGAVKTILVDDSQPVSQLMVVICTK
IGITNHEEYGLVREDNEAQNENLPDNKFGTLTLKRKIMEKDRDAKMESLRKKLKTDDEMN
WVDVSRTLREQGIDEAETVLLRRRFFFSDQNIDSRDPVQLNLLYVQARDAILDGTHPVTQ
DKACEFAGIQVHIQFGPHNEAKHKTGFLDLKDFLPQSYVRTKGIEKKIFSEHRKHADLSE
IDAKVLYTKTARELPTYGVTFFLVKEKMNGKNKLVPRLLGVTKDSVLRLDEHTKEILISW
PLTTVRRWGASPNTFTLDFGDYANQYYSVQTTEAEQIVQLIAGYIDIIIKKKQTKDHFGI
EGDEGSTMVEESVAPSKATFLQHETNSMEQLNVESLAHPGIMRPYDGERSYMENEVQTVQ
YGAFVGQVNHAHQPPSTKEVRISSVNLTEPQRALLGYISAGQDVLIRADEELRTRAPIQE
LGSDLRSIEWRENTLDTSKQAVSSHVATMSAATAQIITASHPDEVDTEAISASVSQIAQT
IPEVTKEVRLIAALMENDTNGDQLLEAARNLCSAFSDLLKAAEPESKEPPQHLINAASRV
GEATTHVLSTIAEEEVPENRDLHDMLLALAKAVANTTAALVLRAKNIAASCEDEQARNRV
IGAASQCALATSQLVACAKVVAPTLHNAACREQLEAAAQNVARAVNSLCEVCNEASNDPK
LKADLLAAARDVSKSLTDMLEHVKLSSREHANRTSTELSPVENVIIGTDILVSTHDPQEM
VRHARTLGQTTAQLIQSIKGEADQQQDADMKRHLLSAAKQLADATAKLVEAARLCSSNPH
DSDNQNALRKAAEELREITTTAANTPAMKRGLIQRLEFCSKQAASAATQCISAAQNAVQH
SQDHQTKETLLQDCKRVADTIPRLVTSLKTTRAQPDDPNAQLNLIEAAEQFVEPALQVSK
SSRALQPTVTDIPSATQLSKGALHLGQCVSELHSVAQRARDACGGQELESALEEVRKLHD
VLDDTRQAAIAGQLRPLPGQTVENTADELRKSAKNVGIALSQLLSSVLHNQRSYAGAAGR
DTALALGDFTRSVHGVAATTQNPAIIDCADDVVTSSARLIEQAQRTLQGASNPEALTQAG
REVTGALSATVDCIPGQREVDVALRNVSELSEILSMSEFPPSSRPYATLQSELKQVAEQL
SSAGGEIVVSYSSPALLAESSQNFAANYRDLLSVSMEMAGQTQEEEVRSHMIDSLRHVST
QSCSLLSTAKSIAADPGQPNAKNLLHAAARGVTESINQLVDASIQSAPGQKECDNAMRNI
EALRLMLDYPHEPINELGYFDCVEQATGKSRNLGYAISEMINNAKQSQHVEFSQSVNNVN
DSIQGLIESSSQAAYLIGVSHPSSVAGRPGIIDQAQLTWAYQGIRQHCDIVSSQQSTKPQ
MISALTVIAKHTSYLCSICRQASMNTSNPVAKNEFIVLAKQVATATSDLVQAIKAIEEQP
SGGSRERLVDPLLEAVKAVRQYASSSEFSSVPAKISAEGRKAQEPVIQAGRGVIDGVVEM
VKAAKSLALTPDNPPVWQQLSMHSTPVSESVKRLVDNIRDKAPGQAQCEQVLHTLGTCTR
ELDSCALAVNAQGLSQRRDNNLHGFSGQTMNSASELIDKLEPIRVAGKNNAEQLGHAVGE
ISRYVVPMVNGAIGACTHIVHSQQQMSLIQQTRSVVESAITLVQSAKDSAGNPRATHAHP
RLDDAIDGTREAIQELQQTVEKINAETGIVTGLMEQVNRSITRLTDKRQSLLNASYSDTF
VDYQTRMVARAKEIASLANEMNAKSSVEPSALPQLAVDMTQNYQQLTQDSVGASTTTSSP
DVAMRIRTTVVDLGRSVSSMIQSSAGGARPNDVGAQKEIARSAREVSEKVAQVLAALQAG
SRGTQACINAAHTVSGIIGDLDTTIMFATAGTLHSDGDGSFADHREHILQTAKALVEDTK
VLVTGAAGTQDQLANAAQNAVSTITQLAEAVKRGACSLGSAQPDSQVMVINAVKDVASAL
GDLINCTKLASGKSINDPSMQDLKESARVMVLNVSSLLKTVKAVEDEHTRGTRAMEATVE
AISQEIRAMHTPPPVGNTQVGPEDLIRVTMNVTAATAKAVAAGTSNLQTDIVSAANLGRR
AISEMLIVCRSVAWNCAETEELRTRTLEAGTAVGESYRDLLSGILHNCSADDRMHLSRRV
AKCVTDLVAMARLLKGSDWIDPEDPTVIAENELLGAAASIDAAAKKLASLRPRRQADVKI
ELDENMKFDEMILEAAKGIMGASAALVRAANAAQRELIDTGKVARRPLTSSDDGQWSEGL
ISAARLVAAATHSLVEAAQNLVRGVGTEVMLISTAKQVAASTAQLLIACKVKSNPNSEAG
RRLQAAGNAVIKSTDNLVHSAQQGLEVEEERSLTINTSMVNGMTQEINARSAVLRKEKEL
EEARQLLKNVRHAQRYAKNAQGFTTDESDTEYAYRSQNNTLGRSGYYGSSELPSSPSYLS
GGQQQKHHYNYASPQPQHFHHPGAVSPPPSNYPPMDDPNGDFPPPPPPLSTTISNMQTAT
SGHSFRPNPKLTANAVPRPYPGSPGGSNGLNSAPTTSGTPTNTNYQQSYESSSIKTLNSS
PPAVPKKPTANRNLAACVQDLHDKTFGQGGVVQLTGGNGYPGQNYEGYTSRYETRNFDKS
ANNTTSSSSELGAVKPLESSFSQMTLNTDGGKISIVDQGSERLTSMTQRVMERKSFTTTT
ESRSETKTEKHSFRLD
Download sequence
Identical sequences B4PG07
7245.FBpp0265762 XP_002093439.1.41174 XP_015049542.1.41174 XP_015049543.1.41174 FBpp0265762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]