SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015102099.1.17985 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015102099.1.17985
Domain Number 1 Region: 237-333
Classification Level Classification E-value
Superfamily Immunoglobulin 1.07e-19
Family I set domains 0.0069
Further Details:      
 
Domain Number 2 Region: 345-674
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 3.27e-17
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.042
Further Details:      
 
Domain Number 3 Region: 161-250
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000121
Family I set domains 0.027
Further Details:      
 
Domain Number 4 Region: 2-36
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000263
Family Ovomucoid domain III-like 0.017
Further Details:      
 
Domain Number 5 Region: 82-155
Classification Level Classification E-value
Superfamily EF-hand 0.0000000488
Family Calmodulin-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015102099.1.17985
Sequence length 736
Comment PREDICTED: follistatin-related protein 4 isoform X1 [Vicugna pacos]; AA=GCF_000164845.2; RF=representative genome; TAX=30538; STAX=30538; NAME=Vicugna pacos; AL=Scaffold; RT=Minor
Sequence
MPVCGSDGRVYENHCELHRAACLLGKKIGIAHSKDCFLKGDPCTMADYARLKKVLLALQT
RLQPLHEGDSRQDPASQKRLLVESLFKDLDADGDGHLSSSELAQHVLEGQDLEEDFLGCS
PGDLLRFDDYNRDGSLTLHEFYTAFQVVQLSLAPEERVNVATVTVGLSTVLTCAIRGDLR
PPIVWKRNGLALNFLDLEDINDFGEDDSLYITKVTTIHMGNYTCHASGYEQLFQTHVLQV
NVPPVIRVYPETQAQEPGVAASLRCHAEGIPMPRITWLKNGMDVSTQMSKQLSLLANGSE
LHIGSVRYEDTGAYTCIAKNEVGVDEDISSLFIEDSARKTRLSVGNMFYVFSDDGIIILH
PVDCEIQRHLKPTEKIFMSYEEICPQREGGATQPCQWASAVNVRHRYIYVAQPALSRVLV
VDVQAQKVLQSIGVDPLPAKLSYDKSHDQVWVLSWGDVHKSQPSLQVITEASTGQGQQLI
HTPFAGVDDFFIPSTNLIINHIRFGFIFNKSDPAIHKVDLETLMLLKTIGLHRHGCVPQA
MAHTHLGGYFFIQCRQDSSSPAAPQLLIDSVTDAVVGPNGNVTGTPHTSPDGRFVVSAAA
TSSQLHVQEITLRGEIQTLYDLKVSQGVSDVAFQGSFTQGNQYYVYATLESQPDLLFLEL
STGKTGVLKGLKEPPVGPAQPWAGPRRIVRDSGLFGQYLLTPARESLFLISGRQNALRCE
VAGVKGGTTVVWVGEV
Download sequence
Identical sequences XP_015102099.1.17985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]