SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015105486.1.17985 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015105486.1.17985
Domain Number 1 Region: 187-364
Classification Level Classification E-value
Superfamily MIR domain 8.63e-50
Family MIR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 1050-1141
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-16
Family SPRY domain 0.053
Further Details:      
 
Domain Number 3 Region: 3922-4000
Classification Level Classification E-value
Superfamily EF-hand 0.00000000012
Family Calmodulin-like 0.059
Further Details:      
 
Domain Number 4 Region: 629-777
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000106
Family SPRY domain 0.052
Further Details:      
 
Domain Number 5 Region: 71-152
Classification Level Classification E-value
Superfamily MIR domain 0.00000314
Family MIR domain 0.021
Further Details:      
 
Domain Number 6 Region: 394-518
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000353
Family IP3 receptor type 1 binding core, domain 2 0.02
Further Details:      
 
Domain Number 7 Region: 2117-2182
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000942
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015105486.1.17985
Sequence length 4880
Comment PREDICTED: ryanodine receptor 2 [Vicugna pacos]; AA=GCF_000164845.2; RF=representative genome; TAX=30538; STAX=30538; NAME=Vicugna pacos; AL=Scaffold; RT=Minor
Sequence
MMVVMMTFPLSAQNVPPDLSICTFVLEQSLSVRALQEMLANTVEKSEGKVDVEKWKFMMK
TAQGGGHRTLLYGHAILLRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIH
PASKQRSEGEKVRVGDDLILVSVSSERYLHLSYGNGSLHVDAAFQQTLWSVAPISSGSEA
AQGYLIGGDVLRLLHGHMDECLTVPSGEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVA
WSGSHIRWGQPFRLRHVTTGKYLSLLEDKSLLLMDKEKADVKSTAFTFRSSKEKLDVGVR
KEVDGMGTSEIKYGDSVCYIQHINSGLWLTYQSVDVKSVRMGSVQRKAIMHHEGHMDDGL
NLSRSQHEESRTARVIRSTVFLFNRFIRGLDALSKKVKASTVDLPIESVSLSLQDLIGYF
HPPEEHLEHEDKQNRLRALKNRQNLFQEEGMINLVLECIDRLHVYSSAAHFADVAGREAG
ESWKSILNSLYELLAALIRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVLVESP
EALNIIKEGHIKSIISLLDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLL
LQTRLVNHVSSMRPNIFLGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWASTEGY
SPYPGGGEEWGGNGVGDDLFSYGFDGLHLWSGCIARTVSSPNQHLLRTEDVISCCLDLSA
PSISFRINGQPVQGMFENFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCY
EAVLPKEKLKVEHSREYKQERTYTRDLLGPTVSLTQAAFTPIPVDTSQIVLPPHLERIRE
KLAENIHELWVMNKIELGWQYGPVRDDNKRQHPCLVEFSRLPEQERNYNLQMSLETLKTL
LALGCHVGISDEHAEEKVKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENA
HNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYALLDDRTKKSNKDSLREAVRTLLGYGYS
LEAPDQDHAARAEVCSGTGERFRIFRAEKTYAVRAGRWYFEFEAVTAGDMRVGWSRPGCQ
PDQELGSDEHAFAFDGFKAQRWHQGSEHYGRPWQAGDVVGCMADVTERTMVFTLNGEILL
DDSGSELAFKDFDVADGFIPVCSLGVAQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNT
NRDITMWLSKRLPQFLQVPSNHEHIEVTRIDGTIDSSPCLKVTQKSFGSQNSSTDIMFYR
LSMPVECAEVFSKTAAGGIPGAGLFGPKNDLEDYDADSDFEVLMKTAHGHLVPDRVDKDK
EAAKPECNNHKDYAQEKPSRLKQRFLLRRTKPDYSTSHSARLTEDVLADDRDDYDYLMQT
STYYYSVRIFPGQDPANVWVGWITSDFHQYDTAFDLDRVRTVTVTLGDEKGKVHESIKRS
NCYMVCAGESMSPGQGRNSNGLEIGCVVDAASGLLTFTANSKELSTYYQVEPSTKLFPAV
FAQATSPHVFQFELGRIKNVMPLSAGLFKSEHKNPVPQCPPRLHVQFLSHVLWSRMPNQF
LKVDVSRISERQGWLVQCVEPLQFMSLHIPEENRSVDILELTEQEDLLKFHYHTLRLYSA
VCALGNHRVAHALCSHVDEPQLLYAIESKYMPGLLRAGYYDLLIDIHLSSYATARLMMNS
EFIVPMTEETKSITLFPDENKKHGLPGIGLSTSLRPRMQVSSPSFVSISHESYQYSPEFP
LDVLKAKTIQMLTEAVREGSLHARDPVGGTTEFLLVPLIKLFYTLLIMGVFHSRDLKHVL
QLIEPSVFKEAAAPDEESEVLEGESCTEDPKPDGATEEEAKGGKRPKEGLLQMKLPEPVK
LQMCLLLQYLCDCQVRHRIEAIVAFSDDFVAKLQDNQRFRYNEVMQALNMSAALTARKTK
EFRSPPQEQINMLLNFKDDKSECPCPEEIRDQLLDFHEDLMTHCGIELDEDGSLDGNSDL
TIRGRLLSLVEKVTYLKKKQAEKPVESAAKKSSTLQQLISETMVRWAQESVIEDPELVRA
MFVLLHRQYDGIGGLVRALPKTYTINSVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMI
RGLGDIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEITFPKMVANCCRFLCYF
CRISRQNQKAMFDHLSYLLENSSVGLASPAMRGSTPLDVAAASVMDNNELALALREPDLE
KVVRYLAGCGLQSCQMLVSKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRL
LIRRPECFGPALRGEGGDGLLAAMEEAIKIAGDPSRDGPSPTSGSSKTLDPEEEEDTIHT
GNAVMTFYSALIDLLGRCAPEMHLIHAAKGEAIRIRSILRSLIPLGDLVGVISIAFQMPT
VAKDGNVVEPDMSAGFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDT
AALSATDMALALNRYLCTAVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKA
QRDSIEVCLLSICGQLRPSMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLP
GGWGSFGAASEEELHLSRKLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDYMESN
YVSMMEKQSSMDSEGNFNPQPVDTSNITIPEKLEYFISKYAEHSHDKWSMDKLANGWIYG
EIYSDSSKVQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRT
RRISQTSQVSVDAAHGYSPRAIDMSNVTLSRDLHAMAEMMAENYHNTWAKKKKLELEAKG
GGNHPLLVPYDTLTAKEKAKDREKAQDILKFLQISGYAVSRGFKDLELDTPSIEKRFAYS
FLQQLIRYVDEAHQYILEFDGGSRSKGEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLS
AASRPLCSGGHASNKEKEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDART
VMKTGLESVKSALRAFLDSAAEDLEKTMENLKQGQFTHTRNQPKGVTQIINYTTVALLPM
LSSLFEHIGQHQFGEDLILEDVQVSCYRILTSLYALGTSKSIYVERQRSALGECLAAFAG
AFPVAFLETHLDKHNVYSIYNTKSSRERAALSLPANVEDVCPNIPSLEKLMEEIVELAES
GIRYTQMPHVMEVILPMLCSYMSRWWEHGPENHPGRADTCCTALSSEHMNTLLGNILKII
YNNLGVDEGAWMKRLAVFSQPIINKVKPQLLKTHFLPLMEKLKKKAAMVVSEEDHLKSEA
RGDMSEAELLILDEFTTLARDLYAFYPLLIRFVDYNRAKWLKEPNAEAEDLFRMVAEVFI
YWSKSHNFKREEQNFVVQNEINNMSFLITDTKSKMSKAAVSDQERKKMKRRGDRYSMQTS
LIVAALKRLLPIGLNICAPGDQELIALAKNRFSLVRVLSLLVDVTTPPPHAPPSLEDPAI
RWQMALYKDLPNRTEDTSDPERTVERVLDIANVLFHLEQKSTSMRRRYYNLVEHPQRSKK
AVWHKLLSKQRKRAVVACFRMAPLYNLPRSESLCCLWCSCSAPSHKLEEDFLYMAYADIM
AKSCHDEEEDDGEEEVKSFEVTGSQRSKEKEMEKQKLLYQQARLHDRGAAEMVLQTVSAS
KGETGPMVAATLRLGIAVLNGGNSTVQQKMLDYLKEKKDVGFFQSLAGLMQSCSVLDLNA
FERQNKAEGLGMVTEEGSGEKVLQDDEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTT
VNIIISTVDYLLRVQESISDFYWYYSGKDVIDEQGQRNFSKAIQVAKQVFNTLTEYIQGP
CTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIELLKELMDLQKDMVVMLLSMLE
GNVVNGTIGKQMVDMLVESSNNVEMILKFFDMFLKLKDLTSSDAFKEYDPDGKGVISKRD
FHKAMESHKHYTPSETEFLLSCAETDENETLDYEEFVKRFHEPAKDIGFNVAVLLTNLSE
HMPNDSRLQTFLELAESVLSYFQPFLGRIEVMGSAKRIERVYFEISESSRTQWEKPQVKE
SKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAAQISESDLNERSASKEESEKERPE
EPGPRMGFFSLGTVRAALLALRYNVLALMRMLSLKSLRKQVKRVKKMTVKDMVTAVFTSY
WAVFLSLLHFVASVFRGFSRILCSLLLGGSLVEGAKKIRVAELLANMPDPTQDEVRGDGE
DAERKATEAALPSEDLTDLKELTEESDLLSDIFGLDLKREGGQYKLIPHNPNAGLSDLMS
SPVPIPEVQEKFQEQVPKEEEKEEKEESRSEPEKAEGEDGEKEDKAREDKGKPRPRQLHT
HRYGEPEAPESAFWKKIIASQQKLLNYFARNFYNMRMLALFVAFAINFILLFYKVSTSSV
VEGREPPPRSSGENTRGSSLDGGSPRVIAVHYVLEESSGYMEPTLRILAVLHTVIAFFCI
IGYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSEDDIKGQWDRLVINTQSFPNNYWDK
FVKRKVMDKYGEFYGRDRISELLGMDKAALDFSDAREKKKPKKDSSLSAVLSSVDVKYQM
WKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQL
VLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDTPDMKCDDMLTCYMFHMYVGVRAGGGI
GDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETK
CFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQER
CWEFFPAGDCFRKQYEDQLN
Download sequence
Identical sequences XP_015105486.1.17985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]