SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015124411.1.60272 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015124411.1.60272
Domain Number 1 Region: 553-613
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-16
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 148-200
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000128
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 296-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000168
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 470-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000047
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 5 Region: 607-668
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000135
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 524-579
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000119
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 7 Region: 411-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000239
Family Classic zinc finger, C2H2 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015124411.1.60272
Sequence length 1059
Comment PREDICTED: zinc finger protein 569-like [Diachasma alloeum]; AA=GCF_001412515.1; RF=representative genome; TAX=454923; STAX=454923; NAME=Diachasma alloeum; AL=Scaffold; RT=Major
Sequence
MDVSGDLTLQWVEEVGNVIHEEVICGLEADLETQEGEVIGACEEVCIEEDGQGGSEQEAT
QDLPPDTEILMVPQSSDMESIYIVPQDQGHDYLNIQVTEEVITDNWDRSGPEDGVEIPET
KVSHDNLLEYDDMEIPLPIDQDSYTNTRPYPCDFCSRRFRKKANLMNHMVAHQTDRPHGC
NLCGARYVRKCDLMNHLKIHAYAPTRDGLEDDLQSEDLPDDDDPPKGRRKKPQAPRKRKA
IQKRPLNPLDTSLDHADKPPRLQKSFDYVDEDMRLLEEMTTRPNSAPRWPITDPTKPYVC
QYCGVGFAREKALASHARIHGGDSPFECTNCGDMFWDVNALRDHIRIKHGVTQSPIDEFE
ASETPYTGDDRFGEFYCETCGVPFHRLDLLKRHRKIHVKQEGGSEQVDASNHHVCNVCGE
WFEEALALLAHAELHARSPTRRCLLCGERCRDDAEVAEHVRLIHGEDAPPNTCTLCGKTC
KDKRSLLKHSWVHNTDKTFGCTKCGKRFHSKARLRRHMVSHRNKMVACDECGEEFPDGRA
LVSHRHSHNKELGGRSFPCRECGKTFGSRSSQQIHIRIHTGERPYGCRFCWKAFADGGTL
RKHERIHTGEKPYGCAICPRAFNQRVVLREHVRAHHSGPDPKCHGSLTPYLCKVCGDSFG
SSEEIILHIVQHCDDNTALRRQPQVGPRKYKRRRKLKPHESPTIPQRNEFDTVELSESDE
NSKRKTKKSTKRSIDEGYQSVLKSFESSIQNINSIVSSTKASKSGKVKKKLKKEEKKVPE
SSTASNSGRPKMIHTQKTRVPVEVGSDGVKKGQKTKTMVTRTPKVMPGERGIFLGGERNR
PRTKNVSYHVDGRNVIPATFPGITAEIIEAPPAQLAEPEPAPPSSTPTPTPPPPQEFVQV
NVKSEPQMTTRRSAANYSNGDNLNLPEIEAKKKVKKGGKRVGRPIKQEPREEVVEEHLPE
DEVVDEVPKVAMEMEVGFEETMEENGESILPDLESVHHNVVVPDKVSLRVKVEPAATRRL
LEEEVPETIVPDTLEYTCEMCSAVFSSRAELLVHVPIHI
Download sequence
Identical sequences XP_015124410.1.60272 XP_015124411.1.60272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]