SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015126044.1.60272 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015126044.1.60272
Domain Number 1 Region: 252-318
Classification Level Classification E-value
Superfamily Homeodomain-like 4.71e-21
Family Homeodomain 0.0025
Further Details:      
 
Domain Number 2 Region: 63-130
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000357
Family LIM domain 0.011
Further Details:      
 
Domain Number 3 Region: 34-62
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000038
Family LIM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015126044.1.60272
Sequence length 390
Comment PREDICTED: LIM/homeobox protein Lhx9-like [Diachasma alloeum]; AA=GCF_001412515.1; RF=representative genome; TAX=454923; STAX=454923; NAME=Diachasma alloeum; AL=Scaffold; RT=Major
Sequence
MLKEVGCGSSTPPPGDVTAGRRENQGDSGNSEGGLACGGCGRDITERWYLRAADRAWHCG
CLRCCHCRVPLAAELTCFSRDGNIYCKEDYYRLFAVSRCSRCRAGISASELVMRAREFVY
HVACFVCASCGVPLNKGDHFGQRDGLVYCRPHYELICCTADYGSTPGSVEDLGSPGVSPL
PSYYSAPEQSPVTSVGSAQKGRPRKRKLSEVTGSEMPVTMRLASSALELLHPNELSSSME
SLTAYDTSVGSPGPVHQSQRTKRMRTSFKHHQLRTMKSYFAINQNPDAKDLKQLAQKTGL
SKRVLQVWFQNARAKWRRNMMRQEGNHGVSNVGCPGTPVSSSTANSPNIGPNSAFLGDSN
SQPSTSMEEIHALHHLHSGVSSQVSFSDLY
Download sequence
Identical sequences XP_015126044.1.60272 XP_015126045.1.60272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]