SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015131471.1.86415 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015131471.1.86415
Domain Number 1 Region: 340-390
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000144
Family TSP-1 type 1 repeat 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015131471.1.86415
Sequence length 849
Comment PREDICTED: thrombospondin type-1 domain-containing protein 1 isoform X1 [Gallus gallus]; AA=GCF_000002315.4; RF=representative genome; TAX=9031; STAX=9031; NAME=Gallus gallus; breed=Red Jungle fowl, inbred line UCD001; AL=Chromosome; RT=Major
Sequence
MKQMLKDFSNLLLVVLCDYVLGEVEDLLLKRPGHVAFSKDTVSVEYHYYSGNETAENLSI
LLLDANTNKIIARKQLPVNQSRGMVEFECFYFTSAGDFLFRMISPSDNSSAAASGRRTST
LHVEWPVFHIDLNKTSEVLGSSLQVGVFTNEQLCAMNETVVSLDVIFTSTLYELGRVSSD
EMLGIRTSKGIPLSRSQWVEFDCPHVGQEMYITVLLKSLETHSVIASMGPIDLHKFGYRL
VVAPEAVCRTLVQVFIVSPPCTSISGKVVVYKEALKHPSLRTTWLYENTLHPGDNRTEFN
CTLFDVGKNKYCFDLYNFSNRSHFPTRVKQCMMIQRNMETWSPWQPWSPCSVTCGDGIRE
RFRECFTSSPVKPGCAGSPKETSLCSLEECLTVKAPTPPSVQPGEDQKANNIVTITGISL
CLFIIFATVLITLWRKLCRAQKCSTAMRRNSIHSPGFRKNSDEENICQGNKQRDSFTEGG
DAPVNIPLTYRRSLQFAQEDDASGSESFQPNAQKIIPPIFSYRLAQQQLKEMKKKGLTET
TKVYHVSQNPLTDTVVGATTMLPLSAETQEEGAANKFRIKSPFLDQAAGQPKFVGEGCNP
RLDFPFSQASAAMSSTQTLIRRAHFKHPDNRGELCERGCHRNPQFRRTASFHETKKARPF
RERSMSTLTPRQTPLYTSRTRTWDQGLEDRTRPKLRNTNPTSEKLDQPHGTAPTCEPQGH
GTKGHHRACPPVKKLDLIADRQHAGQERGPEKPEPSRSKRGPSPNPKGAWRKETGSAGKE
SHQRGLTVSPAQYRKDKCQSFPVDPEFAFYDNTSFGLTEAEQQMIDLPGYFGSNEEDERS
TLSMEKLMI
Download sequence
Identical sequences 9031.ENSGALP00000027459 ENSGALP00000027459 ENSGALP00000027459 XP_015131464.1.86415 XP_015131467.1.86415 XP_015131471.1.86415 XP_417078.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]