SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015131660.1.86415 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015131660.1.86415
Domain Number 1 Region: 11-160
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.83e-52
Family APC10-like 0.0000000826
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015131660.1.86415
Sequence length 185
Comment PREDICTED: anaphase-promoting complex subunit 10 isoform X1 [Gallus gallus]; AA=GCF_000002315.4; RF=representative genome; TAX=9031; STAX=9031; NAME=Gallus gallus; breed=Red Jungle fowl, inbred line UCD001; AL=Chromosome; RT=Major
Sequence
MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQ
PHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEVRQLELVEPSGWI
HVPLTDTHKKPIRTFMIQIAVLANHQNGRDTHMRQIKVYTPVEESSIGKFPRCTTIDFMM
YRSIR
Download sequence
Identical sequences Q5ZL04
ENSGALP00000041606 9031.ENSGALP00000016158 NP_001008467.1.86415 XP_015131660.1.86415 XP_015131661.1.86415 ENSGALP00000016158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]