SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015138659.1.86415 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015138659.1.86415
Domain Number 1 Region: 399-785
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 3.27e-127
Family Oxysterol-binding protein 0.0000391
Further Details:      
 
Domain Number 2 Region: 146-266
Classification Level Classification E-value
Superfamily PH domain-like 9.11e-23
Family Pleckstrin-homology domain (PH domain) 0.000000603
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015138659.1.86415
Sequence length 890
Comment PREDICTED: oxysterol-binding protein-related protein 8 isoform X1 [Gallus gallus]; AA=GCF_000002315.4; RF=representative genome; TAX=9031; STAX=9031; NAME=Gallus gallus; breed=Red Jungle fowl, inbred line UCD001; AL=Chromosome; RT=Major
Sequence
METVLVDGELDRNSHHGDNRDSHGPSTVVTNSDESQLLTPGKMSQRQGKEAYFTPTKELL
QPSLSPATAHSHGFDKGKDEASQSKEDTAHSMSKSKSESKLFNGSEKDISLSSSKLTKKE
SLKVQKKNYREEKKRATKELLSTITDPSVIVMADWLKIRGTLKSWTKLWCVLKPGVLLVY
KTPKNGQWVGTVLLNACELIERPSKKDGFCFKLFHPLEQSIWAIKGPKGEAVGSITQPLP
SSYLIIRAASESDGRCWMDALELALKCSSLLKRTMIREGKEHDLNSSSDSAHVSLYGLLR
ANNLNSGDNLPLNDSEIERHHFKDQDMYSDKSDKENDHEHDESDNDGLGKSEESDSDTSE
RQDDSYVDPEPIDIKETTYLEQSHEELGEAGEAAQTEVVSEENKSLIWTLLKQVRPGMDL
SKVVLPTFILEPRSFLDKLSDYYYHADFLSEAALEENAYNRMKKVVKWYLSGFYKKPKGL
KKPYNPILGETFRCMWIHPRTNSKTFYIAEQVSHHPPISAFYVSNRKDGFCLSGSILAKS
KFYGNSLSAILDGEGRLTFLNRGEDYVMTMPYAHCKGILYGTMTLELGGTVNITCEKTGY
SATIEFKLKPFLGNNDSVNQISGKIKLGKEVLAILEGHWDSEVTIRDKKTDVSETFWNPT
SDIKQRRLPRYTVKFEEQDDFESEKLWQQVTKAINNKDQTEATQEKYVLEEAQRKSAKER
KLKGEEWTCKLFDQDSVTGEWHYRYADTRPWDPLNDMIQFEKDGTIQTKVRHRTPMVTVP
KIKRKPTGQKKGECGFSSPEPDNQDSSGSEAQLTKHNTRIRKKGADLGELQSAIESIKET
QEDIKRDIMALRNRVTSNSPPVDNQFLQLKHYIFILLLVLLQLIINFLFK
Download sequence
Identical sequences A0A1D5PGC8
XP_015138649.1.86415 XP_015138651.1.86415 XP_015138659.1.86415 ENSGALP00000016641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]