SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015150434.1.86415 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015150434.1.86415
Domain Number 1 Region: 30-176
Classification Level Classification E-value
Superfamily C-type lectin-like 8.22e-38
Family C-type lectin domain 0.0000956
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015150434.1.86415
Sequence length 188
Comment PREDICTED: C-type lectin domain family 2 member E isoform X1 [Gallus gallus]; AA=GCF_000002315.4; RF=representative genome; TAX=9031; STAX=9031; NAME=Gallus gallus; breed=Red Jungle fowl, inbred line UCD001; AL=Chromosome; RT=Major
Sequence
MEEVREYPHVLGTEWSRREGPSRGACVTFQLTMAAVFTVLLITAVAFAVQAFQPHPQPCA
QCPFDWIGFRGKCYYFSEDESNWTSSQNNCSALGASLAVFDSAEDLSFTMRHKGSSPHWV
GLSREGKEHPWEWVNRSPLSHLFQVQGDGLCAYLGDAGLSSSHCSARRNWVCTKPALQKP
RKNFCIST
Download sequence
Identical sequences A5HUL1
ENSGALP00000000182 XP_015150434.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]