SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_015172502.1.70865 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015172502.1.70865
Domain Number 1 Region: 573-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.32e-17
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 2 Region: 144-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000234
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 316-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000003
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 627-688
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000719
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 490-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000012
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 6 Region: 544-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000231
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 7 Region: 431-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000318
Family Classic zinc finger, C2H2 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015172502.1.70865
Sequence length 1094
Comment PREDICTED: zinc finger protein 658B [Polistes dominula]; AA=GCF_001465965.1; RF=representative genome; TAX=743375; STAX=743375; NAME=Polistes dominula; AL=Scaffold; RT=Major
Sequence
MDVTGDLTLQWVEEVGNVIHEEVICGLEAELVAPEEEVIGACEEVTVEETGESVSNVPPT
TESEILMVPQTNDMDSIYIVPQDQGHDYLNIQVTEEVIADNWDRSGPDDGVEIPETKVSS
DNLLEYDDMEIPLPTDQDSYTNIRPYPCDFCSRRFRKKANLMNHMVSHQTDRPHHCNLCG
ARYVRKCDLMNHLKTHAYAPSRDGLDDDLNDDDSLAPEEEETNKGRRKKVQSNAPRKRKN
NSTIPKRSDDIKIEMNKYVNKSYDYVDEDMRLLEEMTNRNPVRGNNYPSSSRWNEQISPV
PHEQQPPRWPITDPTKPYVCQYCGVGFAREKALASHARVHGGDSPFECTSCSEMFWDVNS
LKEHVRIKHGGTTQLDIEDYDTNDATYTGDERFGEFCCNTCGVPFQRLDLLKRHQKIHVK
QEIDIMEGSSQHHVCNVCGEWFEEALALLAHAELHARSPSRRCLLCGQRCRDDAEVAEHV
RQNHAEDAPPNTCTLCGKTCKDKRSLIKHSWVHNVDKTFDCTKCGKQFHSKARLRRHMVS
HRNKMVQCEECGEEFPDGRALVSHRHFHNKELGGRSFPCHECGKTFGSRSSQQIHIRIHT
GERPYGCRFCRKAFADGGTLRKHERIHTGEKPYGCAICPRAFNQRVVLREHVRAHHSGPD
PKCVGSITPFLCKVCGDAFATSEQIVAHIVQHCDDNTALKRQPQTGPRKYKRRRKLKPHE
TTTMLRINENYDTLEGGSDSDDNTKRKLGRKNKQHRSNVEEGYQNVLKSFESSLQNINSI
VTNSKLNPAKSKLSKKKLRKEEKKNEGQTTCQSGRPKMIHTQKTRVPVEMGSDGVKKGQK
TKTMVTRTPKVMPSEHKLGIFTGGERNRPRTKNVSYHIEGKLQLTPATFPKPKEEDVKLS
TQVQPPMLTNIKIEPGVQKSVDSNHSNNHSNIVKINNDKLDRTPRKKSTVFKKIKKQKQI
NIKEEPNENINESETQNNNNTENTNSIRLMEEHTVDGGSLEVAFEANVVTAEEETILPDI
DTVTNNDNIGNGNVQLSVKVESTPQRIMAVHSVITPVDEVAETIIPDTLEYTCEMCSMVF
SSRAELLVHVPIHI
Download sequence
Identical sequences XP_015172499.1.70865 XP_015172500.1.70865 XP_015172502.1.70865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]