SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015198961.1.81211 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015198961.1.81211
Domain Number 1 Region: 107-337,381-430
Classification Level Classification E-value
Superfamily MFS general substrate transporter 9.68e-50
Family LacY-like proton/sugar symporter 0.04
Further Details:      
 
Domain Number 2 Region: 550-691
Classification Level Classification E-value
Superfamily MFS general substrate transporter 7.19e-19
Family Glycerol-3-phosphate transporter 0.039
Further Details:      
 
Domain Number 3 Region: 454-533
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000000000222
Family Pentapeptide repeats 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015198961.1.81211
Sequence length 696
Comment PREDICTED: synaptic vesicle glycoprotein 2B-like [Lepisosteus oculatus]; AA=GCF_000242695.1; RF=representative genome; TAX=7918; STAX=7918; NAME=Lepisosteus oculatus; AL=Chromosome; RT=Major
Sequence
MDDPYHSNFYQGPQGGSNTYSTFEEGRADPDGYYRGNEYSAQDEDAASDVTEGHDEDDEV
YEGEYQGIPHPDEIKARDRAARAAVQAQEVSDGAVGKMQDEEQLAHQYEAIIEECGHGRF
QWTLFFVAGLALMADGVECFVVGFVLPSAEKDMCLSNANKGMLGLIVYLGMMLGAFIWGG
LADKMGRKRCLIIALAINSIFAFLSSFVQGYDLFLFFRLFSGIGIGGSIPIVYAYFSEFL
SREKRGEHLSWLCMFWMIGGIYASSMAWGIIPHYGWGFSMGTEYHFHSWRVFVLVCALPA
IASLIGLTFMPESPRFLLENAKHDEAWMILKQVHDTNMRAKGEPEKVFTVSHIKTPKQDD
EFIEIQSSTGTWYQRWMVRIMTVIKQVLQNVLSLFSPQLRLNTLFMAIIWFTMAFSYYGL
TVWFPDMIKYLQNEEYESKVKVIRRERVEHFTFNFSLENQIHREGEYFNDKFTKIEMKSV
TFEDSLFEECFFEDIRSTDTFFKNCTLINNVFYNTDLNKEKFIDCKMVNTTFLHPKQGCH
LDYEEENDVLIYLVSFLGSLAVLPGNIISALFMDKIGRIKMIGGSMLISSVCTFLLFFGS
SESAIIGWQCLFCGTSVAAWNGIEVITVELYPTNKRATAFGVLNALCKFAAILGSSIFAS
FVGITKVIPILMASSALVAGGLLALKLPETREQVLM
Download sequence
Identical sequences W5NB41
ENSLOCP00000017850 XP_006628941.1.81211 XP_015198959.1.81211 XP_015198960.1.81211 XP_015198961.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]