SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015200541.1.81211 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015200541.1.81211
Domain Number 1 Region: 151-351
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.85e-54
Family Prokaryotic proteases 0.000000517
Further Details:      
 
Domain Number 2 Region: 366-443
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000145
Family HtrA-like serine proteases 0.0038
Further Details:      
 
Domain Number 3 Region: 24-102
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000235
Family Growth factor receptor domain 0.0014
Further Details:      
 
Domain Number 4 Region: 89-134
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000613
Family Ovomucoid domain III-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015200541.1.81211
Sequence length 450
Comment PREDICTED: serine protease HTRA3 isoform X2 [Lepisosteus oculatus]; AA=GCF_000242695.1; RF=representative genome; TAX=7918; STAX=7918; NAME=Lepisosteus oculatus; AL=Chromosome; RT=Major
Sequence
MKLFLFGGVLLVIQEFIDAEPRPKCPSRCDVSRCPSPSCPSGYVPDRCNCCLVCAHGEGD
PCGRKDDLPCGDGLECKHPAGKRLAKGVCQCKLAYKVCGNDGKTYGNVCQLKAMSRKALQ
QGLPAIIQVQKGPCESGPQHPNSPRYKFNFIADVVEKIAPAVVHIELFIRHPLFGRNVPL
SSGSGFIMTETGLIVTNAHVVTSTTAVSGRQQLKVQMHNGDTYEATIKDIDKKSDIATIK
VNPQKKLPVLLLGQSADLRPGEFVVAIGSPFALQNTVTTGIVSTAQRDGKELGLRDSDMD
YIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDRITRFLNESHDKHSKEL
KAVKKRFIGIRMLTITPGLVEELKQQDSDFPDVSSGIYVHEVVPNSPAQKGGIKDGDIIV
KLNGRPLLSTGDLQEALMNESPLLLEASLC
Download sequence
Identical sequences W5MW45
XP_015200541.1.81211 ENSLOCP00000012604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]