SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015203481.1.81211 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015203481.1.81211
Domain Number 1 Region: 35-519
Classification Level Classification E-value
Superfamily Sema domain 4.84e-98
Family Sema domain 0.00073
Further Details:      
 
Domain Number 2 Region: 1384-1509,1675-1857
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-34
Family p120GAP domain-like 0.026
Further Details:      
 
Domain Number 3 Region: 859-950
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000777
Family Other IPT/TIG domains 0.0085
Further Details:      
 
Domain Number 4 Region: 951-1027
Classification Level Classification E-value
Superfamily E set domains 0.0000000000216
Family Other IPT/TIG domains 0.03
Further Details:      
 
Domain Number 5 Region: 522-574
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000379
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 1042-1122
Classification Level Classification E-value
Superfamily E set domains 0.0000000165
Family E-set domains of sugar-utilizing enzymes 0.044
Further Details:      
 
Weak hits

Sequence:  XP_015203481.1.81211
Domain Number - Region: 819-856
Classification Level Classification E-value
Superfamily Plexin repeat 0.0129
Family Plexin repeat 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015203481.1.81211
Sequence length 1899
Comment PREDICTED: plexin-D1 [Lepisosteus oculatus]; AA=GCF_000242695.1; RF=representative genome; TAX=7918; STAX=7918; NAME=Lepisosteus oculatus; AL=Chromosome; RT=Major
Sequence
MPPSDRVVLLLGVLILVSCLSIRQHFGCALQLQQKFTSLQQTNNFAVDEHSRKVYLATVN
RIYQLNGTLSLEIEEKTGPVNDSLLCHAPQLPQTICEHPKVQTDNYNKLLQLDQGQGVVV
VCGSVYQGFCELRKLGNISEIAVRFPPQGENKVTVFPSMLNIAANHPNASTVGLILRGPA
GNTRLLVGATYTGVGTPFFPKNYTKEDLRFENTPEIAIRSLNLNDLSKLFTYDINPSEDN
VFKIKQEVKTKNKLSFVHAFIEKSYSYIAINNDANQGQKENHPNSILARICLDSESKRKS
ATESRKLTESYIQMGLQCGSNGNIYNRIVSVYPARIYVSDKQNPEEFLFGVFAKSNKNTA
LCVYPFSEIEKVIRDGRKKCSSSPGSPDVQVLDSVIQGSGAECVAKQKIVLQMEQLDCGA
AHLQHPLALRRPLQATPIFESVGLTSVAVDSVHTHSVVFLGTASGRLWKLNLLRNLTLAN
KSSLKVAAGESVHHIMIFDPSDRNYLYLMTSRQLLRVKVASCDRYTSCSECLLAGDAHCG
WCTLENRCSIQKECAHQLLPRFWIGLSEGPQQCPSMTITPREIDIATDIKDFGILINGSV
PDLSNTEVECSYGNGVSTRATIYAVNSGPPQIQTCPLLPKDKLPRIQPAEDHVVIPVSIK
VNGTPIVWGNFTIYDCEKTGIVHSKRPCTSCLSTKWKCYWNLERSACVSRKTNPTDTLLE
NSMYCPSVNPSLTRPTATGTAQDITLTLNNTKEGTPLQCDFGNDQLYEATWLDQSTIKCS
SVTLYTTKRSQTVHLNLRLKKHQDKFLDSPLPVTVEVYNCGTGSTDCSQCLGREDEGHFC
SWCDNTCKPRDECQPLKTTCPAPEIWEIEPLSGPLEGGTLLTIRGRNLGRRFTDIVVSIR
HVHCLPIQSQYIVSEKIVCKTGSSASAFSDTVTVNVSQSVGRSQKLFKYLVPEVFSIEPK
NGSRAGGTKVTISGRHLGVGTRVRVKVNGTQECTDLIRTEDTIKCTMPAAKHSKTEAVQV
CVEFEETPCQNSKWVTQYTYEKNPDIAAIRPGTSHLSGGRTITVMGHGFNLVQNVTMEVK
ESREQAQCYVHTNYIISCQSPPALHPMKATVEFYLNGVLYTRESPAAPYGLEDEDEPHSG
LFSLEYLGDPQFHTASKERLIKHHPGEPLTLIINKEPNNLGLSLEEYKVMIGPIPCDISF
NNDQLFHCTINGSLSSNERQLPVTVEVGNFRKVIAMVQLGGSELAIVVSIVVCCVLLLFC
TVALVVYCTKSRRAERYWQKTLVQMEEMESQIREEIRKGFAELQTDMTDLTEELNRSQGI
PFLEYKQFVTRTFFPKMCSDYERSFVQPIYENDALGPRAVQETHPLLQDWKATSNHKPNM
EEGISLFSTLLNNKHFLITFVHALEQQKDFAVRDRCNLASLLTIALHGKLEYYTSIMKDL
LVDLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLKEIVGEPFFLLLCAIKQQIN
KGSIDAITGKARYTLNEEWLLRENIEAKPQNINVSFQGCGMDSLTVRVMNTDTICQVKEK
ILEAFYKNLPFSQWPRAEDVDLEWFASGNDSRLLLDLDDTSVMEDGRKKLNTVFHYKIPE
EASLAMSLKDKRDNTLGRVKDLDTEKYVHLVAPNDELMETKRSQRHSHRKKVLPEIYLTR
LLSTKGTLQKFLDDLFQAVLSIPQDKPPLAVKYFFDFLEEQADRRGITDPDTLHIWKTNS
LPLRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAK
EIPEYKKTVQRYYQQIQEMTPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYKYAKRYRI
QVVNALEANPTTKRTQLQHKFEQVIALVEDNIYECSSEA
Download sequence
Identical sequences W5N5Z3
ENSLOCP00000016052 XP_015203481.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]