SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015214838.1.81211 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015214838.1.81211
Domain Number 1 Region: 342-441
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.01e-31
Family Ras-binding domain, RBD 0.0032
Further Details:      
 
Domain Number 2 Region: 477-588
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000132
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015214838.1.81211
Sequence length 689
Comment PREDICTED: ras-associated and pleckstrin homology domains-containing protein 1 isoform X1 [Lepisosteus oculatus]; AA=GCF_000242695.1; RF=representative genome; TAX=7918; STAX=7918; NAME=Lepisosteus oculatus; AL=Chromosome; RT=Major
Sequence
MEQLSDEELDHAAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDDGKPEKVRKSPLRQEAN
LANFSYRFSMYNINEALNQGDAVDLDALMADLCSIEQELSTIGSKPNSTAKAAGTAEGKV
RQKPPAGRQGSARSASSSARVSPSSTVRGPKPLTTNFSLDDITAQLEQASLSMDEAARQS
PPPPSSSSSFSSSSFCLPPPAAHQHHPHHHHHHHRRTGSAGTVSDHDARSISNSSRSSVA
SAASSMDSLDIDKVLRPPELEGLQQGQPSSEHAPLRRPSKQVRRHLDFAQEEVEVDLNTH
SYLDRETSLILKNIAGKPSHLLTKEEQAAKLKAEKIRVALEKIKEAQVKKLVIRVHMSDE
SSKTMMVDERQTVRQVLDSLLDKSHCGYSPDWALVETIPELQMERIFEDHENLVENLQNW
TRDSQNKLMFIERIEKYALFKNPQNYLLGKKETSEMADRNKEALLEECFCGSSVTVPEIE
GVLWLKEDGKKSWKKRYFLLRASGIYFVPKGKAKVSRDLVCFLQLDHVNVYYGQDYRNKY
KAPSDYCLALKHPQIQKKSQYIKYLCCDDVRTLHQWVNGIRIAKYGRQLYVNYQEAMKRT
EAAYDWSSLSSSSMKSGSSSSSLPESHSNHSNQSDSGVSDTQSSGHVRSQSIVSSIFSEA
WKRGTQMEETSKGSKVKPRTPVLLCTGSD
Download sequence
Identical sequences W5MWE2
ENSLOCP00000012701 XP_015214838.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]