SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015215683.1.81211 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015215683.1.81211
Domain Number 1 Region: 11-185
Classification Level Classification E-value
Superfamily RUN domain-like 8.11e-40
Family RUN domain 0.001
Further Details:      
 
Domain Number 2 Region: 648-738
Classification Level Classification E-value
Superfamily PX domain 1.83e-24
Family PX domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015215683.1.81211
Sequence length 806
Comment PREDICTED: sorting nexin-29 isoform X2 [Lepisosteus oculatus]; AA=GCF_000242695.1; RF=representative genome; TAX=7918; STAX=7918; NAME=Lepisosteus oculatus; AL=Chromosome; RT=Major
Sequence
MSGAQQNDIKRQHLLERLLDAVKQCQIRFGGRKEIASDSDSRVICLCAQFEAMLQHGLRR
SRGLALTAAAFKQVAGFSSKAESELSFWLYVKEHLNRHELQRFYALRQISSEVGRGRAWL
RCALNEHSLERYLHALLADRARLSVFYEDWAFLMDEERASMLPIMAAGLNSILFAINIDN
TDLNGQSRGAPSVSDLLRESTQGVSSLWKESAQGVSTLLREISTATSAVPGFGPRAEHLS
DPLPVLPRSASADSGLKKERRRKKKVTHIISFDDDEEEEGEGGGRLRKGSGRGPGGSEEA
LEVSDPPPTQNGAPDGEVGGWGGPHTTNGEPIDSKSIDNEEEEEEDLYGRSRPEVEEERG
NGEQPLVGSLSSVSTWSPLQVINDNDGSDILIPVDSADSCSQPEGEVQTRGYREVTGRSE
VTQTEPRLGYSTDTSPAAQSTPLNISSPVLPESMTVAELRQAIVAMMNRKDELEEENRSL
RSLLDGEMEHSAGLRQELDSLKKRLGELEERHGAKVQALGRENEVLKVQLKKYVGAVQML
KREGGQSDDALPALGNGDGAPPAPPPKPAGEVEELAASYERKLIEVAEMHGELIEFNERL
YRSLMAKDNLISQMRQELIDLRGPVPGDLSQTSEDPSLSDFETAHRALVNVWIPSVFLRG
RAANAYHVYQVYIRILDNEWNVYRRYTDFRALHQRLRSRFPQVDAFNFPPKKAIGNKDSK
FVEERRKQLQSYLRSVMNKLIQALPEFAARPTKETLLKLLPFCQDTPQATESGTKPARSR
VGPRFPKLTRSQNRESRNPEPQSGDL
Download sequence
Identical sequences W5ML08
XP_015215683.1.81211 ENSLOCP00000009067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]