SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015250228.1.42780 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015250228.1.42780
Domain Number 1 Region: 29-513
Classification Level Classification E-value
Superfamily Sema domain 1.31e-101
Family Sema domain 0.00091
Further Details:      
 
Domain Number 2 Region: 1382-1507,1673-1859
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.88e-34
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 855-946
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000675
Family Other IPT/TIG domains 0.011
Further Details:      
 
Domain Number 4 Region: 1038-1118
Classification Level Classification E-value
Superfamily E set domains 0.00000000000101
Family E-set domains of sugar-utilizing enzymes 0.024
Further Details:      
 
Domain Number 5 Region: 946-1036
Classification Level Classification E-value
Superfamily E set domains 0.0000000000789
Family Other IPT/TIG domains 0.059
Further Details:      
 
Domain Number 6 Region: 516-568
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000349
Family Plexin repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015250228.1.42780
Sequence length 1897
Comment PREDICTED: plexin-D1 isoform X3 [Cyprinodon variegatus]; AA=GCF_000732505.1; RF=representative genome; TAX=28743; STAX=28743; NAME=Cyprinodon variegatus; AL=Scaffold; RT=Major
Sequence
MPPSMEIAVLLLGVLALETRRSASALHIQQAFSSPNLTNNFVVDPVSGKVYLATVNTVYQ
LNGTLSVEVEKSTGPVEDNLLCHAPQLPQAPCEHPKSLTDNYNKLLKLDRDQGVVVVCGS
VYQGFCELRRMGNISEIAVEFPPRGEKTVFPSMLNIAANHPNASTVGLIFKSHGGNTRLL
VGATYTGAGTQFFPKNHSKEDLRFENTPEIAIRSLNTQDLSRLFTYDINPSEDNVFKIKQ
EVKTKNKLNFVHAFIQKTYSYIAFNNDAKMGHKESQPNSILARICLDSDSPRKSTGPESR
KLTESYIQMPLQCGSNGNIYNRLLSVYPATVPAEGGRDPQPYLFGVFSKADAKSALCAFK
FGDIEEEIRQGRRNCSNSPSSDVQVLDSVIQGSGAVCVQKGNLVLQPEQLDCGAAHLQHP
LALRRPLRATPLFEYSSLSSVSVDSVHQHTVVFLGTSNGRLHKLTFLPNRTLASQRTTKL
PAAEAVHHIMTFDPNNSNFLYVMTSHHMLRVKVAECDLWTSCTDCLGAGDAYCGWCTLEN
RCSIQNECARGLMPRSWISIGQGPQQCPSITLTPSEISISAKIEAVGILINGSIPDLIGS
KVECEYKPGVSTVATVYGLSQIQTCPLLPRENYQPIPPGTDHLAVSVAIKVNGTSVVSGS
FIIYDCEKTGQIHPNTPCMSCLSTGWKCYWDQENHLCLSSKDESKLNLLESAASCPSLIP
SDAPPSPSGMAQDFTMNLKNIQKRESLECDFGTESRYEAIWLDNSTVKCSGVTLFTNQRS
QIYHLSLRRAGDFSSQRKDIFLDSPQPMKVEVYNCGAGSSDCSQCWGREDQGHLCGWCEN
SCRPRDDCQPITDVCPAPEINKISPLRGPVEGGTLLTVQGRNLGRRPSELKVSIGDVPCE
LLPERYTVSVELVCRTGRSEHDRTDSVRVEVDQSGMGMSKESFAYLVPSVHFIDPKNGSS
AGGTRVTIHGKHLDIGSQVRVKVNKTQECTITEKTDQMIKCIMPPTLEVDSEPVTVCVEF
EDHPCQEMELSEMYTYEKNPTISSIHPTKSFLSGGRTITVKGQGFNLVQSVIMHVLEIGQ
TNCTVQSTSTIICLSPESSQSQETSVQFILNGVRYTGDSPSFSDDRTVENDRENHKEHFQ
LGYVEDPQFFTANKEKQIKHHSGEPLTLIINQKVPSELELVPEEYLVMIGSYPCNISFHN
DQLFHCTINGQLSSSESELPVTVQVGNFRHMITKVQLGGSEMAIVVSIVVCCVLLLLCTV
ALVVYCTKSRRAERYWQKTLLQMEEMESQIRDEIRKGFAELQTDMTDLTKELNRSQGIPF
LEYKQFVTRTFFPKMCSDYENSLVRHNYENDSLGPRALPETHPLLQDWQANNTTQPNVEE
GITLFSTLLNNKHFLITFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKDLLV
DLIDASASKNPKLMLRRTESVVEKMLTNWMSICMFSYLKETVGEPFFLLLCAIKQQINKG
SIDVLTGKARYTLNEEWLLRENIEAKPQNINVSFQGCGMDSLSVRVMNTDTICQVKEKII
EAFYKNLPFSQWPRAEDVDLEWFDSGSNSKLLQDLDNSSVMEDGRKKLNTVFHYQIPEGA
SLAMSMKDKKECTLERVKDLDTEKYVHLVLPHDELIETKKSHRHSHRKKVLPEIYLTRLL
STKGTLQKFLDDLFLAILSIPPDRPPLAIKYFFDFLEEQADKRGITDPDTLHIWKTNSLP
LRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEI
PEYKKRVQCYYKQIQEMPPLSEQEMNAHLAEESRKYRNEFNTHLALTEIYKYAKRYRNQV
VNALEANPTARRTQLHHKFEQVIALVEDNIYECCSEA
Download sequence
Identical sequences XP_015250228.1.42780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]