SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015251190.1.42780 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015251190.1.42780
Domain Number 1 Region: 9-65
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000622
Family Ankyrin repeat 0.0019
Further Details:      
 
Domain Number 2 Region: 81-121
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000129
Family SOCS box-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015251190.1.42780
Sequence length 171
Comment PREDICTED: ankyrin repeat and SOCS box protein 9-like [Cyprinodon variegatus]; AA=GCF_000732505.1; RF=representative genome; TAX=28743; STAX=28743; NAME=Cyprinodon variegatus; AL=Scaffold; RT=Major
Sequence
MLEWIMIKYFNLLLISGADVNRSLSGDSPLHIAARLSSPELVSALLDHGADHLLVNSEGK
RPLDLTPPDSLVGRLLREAGGIPSLKQLCRLHIRKTVGKRRLGGIPDLHLPKKLLQYLLY
QSEQSTQITSSKQPHTLSFEHSGQQGENLDNLAGQCPSETDYKESLEISES
Download sequence
Identical sequences XP_015251190.1.42780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]