SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015259263.1.42780 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015259263.1.42780
Domain Number 1 Region: 12-51
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000104
Family EGF-type module 0.014
Further Details:      
 
Domain Number 2 Region: 39-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000276
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 136-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000103
Family EGF-type module 0.02
Further Details:      
 
Domain Number 4 Region: 94-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015259263.1.42780
Sequence length 202
Comment PREDICTED: signal peptide, CUB and EGF-like domain-containing protein 1, partial [Cyprinodon variegatus]; AA=GCF_000732505.1; RF=representative genome; TAX=28743; STAX=28743; NAME=Cyprinodon variegatus; AL=Scaffold; RT=Major
Sequence
CASDVDECMNDYNGGCVHECINIPGNYRCTCYDGFMLAHDGHNCLDVDECLDNNGGCQQV
CVNTMGSYECQCTDGFFLSDNQHTCIHRSDDGMNCMNKDHGCAHICREAPFKSGVSCECR
PGFELAKNQKDCTLTCNYGNGGCQHTCEDTDTGPVCGCHQKYALHSDSKTCIEKDEAAIE
SSEFNATSVADVDKRVKRRLHM
Download sequence
Identical sequences XP_015259263.1.42780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]