SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015280719.1.55130 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015280719.1.55130
Domain Number 1 Region: 40-572
Classification Level Classification E-value
Superfamily Sema domain 2.49e-98
Family Sema domain 0.001
Further Details:      
 
Domain Number 2 Region: 1444-1567,1733-1918
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.37e-34
Family p120GAP domain-like 0.02
Further Details:      
 
Domain Number 3 Region: 1007-1097
Classification Level Classification E-value
Superfamily E set domains 0.000000000000019
Family Other IPT/TIG domains 0.051
Further Details:      
 
Domain Number 4 Region: 917-1005
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000205
Family Other IPT/TIG domains 0.0079
Further Details:      
 
Domain Number 5 Region: 575-627
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000131
Family Plexin repeat 0.0027
Further Details:      
 
Domain Number 6 Region: 1097-1185
Classification Level Classification E-value
Superfamily E set domains 0.0000000003
Family E-set domains of sugar-utilizing enzymes 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015280719.1.55130
Sequence length 1957
Comment PREDICTED: plexin-D1 [Gekko japonicus]; AA=GCF_001447785.1; RF=representative genome; TAX=146911; STAX=146911; NAME=Gekko japonicus; AL=Scaffold; RT=Major
Sequence
MVPRARRGASQVLSPDRRRALFCLLLLLLPAPGGGLEVQHKFVSATATNNFALDRSGSRI
YLAAVNRLYQLSGPNLTLEVEEQVGPREDNPLCHAPQLPQASCEHARRPTDNYNKLLQPD
PEQGILVVCGSVYQGFCQLRSMDNISVVAVAFPPGAGGGDDGEQVTVFPSMLNVAANHAN
ASTVGLVLQQPGQDPRLLVAATYTGLGSPFFPRNQSLEDHRFENTPEIAIRALDARGDLA
RLFTFDINPSDDNIFKIKQGSKERHRLSFVHAFLHPPDGPVLPSPLGRPGGSYAYLALNS
EANAREKESHSQSLLARICLGDSAEATTLNGSSGGGGPNGETKKLTESYIQMSLQCGGKA
GSGGTKAGAAGGDLFNRLVSVFPASELLFGVFEKAASPAGFPGPGGRQAPPLSALCVFRF
AEIEEAIRKARHSCFVEPDSGLVTVLDSVVQGTGPACEKRNIQLQPEQSDCGAAHLQHPL
SILQPIKARPVFTSAGLTSVAVSSVNNYTVVFLGTANGRLLKINLNGSMKVISRESITVA
YGEPVHPLMQFDPSDSSYLYLMTSHQIAHVKVSACDQYTTCTECLAAADAYCGWCTLETR
CSLRYECANFVEPNFWISPSGGVNQCPSMTIIPPEINIDEENQAMLIQIHGNIPNLNGMK
MSCNYGNDVTILATAATADSWNQFVYCSFLPREKYPAFPSNQDHVIVQTAVRVNDRNIVW
ANFTIYDCKRTGNSYPKTACISCLSAKWKCYWCTQRYTCVSNASECEGSIQMNKSTDCPH
IVSTSAAPVSTGTSQDITITLKNAAFVKEMPLECHFGADRIFEAQWVNVSTVQCSNVLLY
TSEKRHLFPVNLQLREKPGRFIDSSQMMTVEIYNCATGSADCSQCLGREDLGHQCIWSES
SASCRLNTESLQIPGACPPPEVRKIEPLNGPLEGGTLVTIRGRNLGRRFSDVVNAVRIGN
VKCSPLQDRYIVSEEIVCWTGEATEEFSDVVTVNVSREGRSRERFSYVLPVVKFISPSTG
PKAGGTKVTIAGNNLNVGSELHVLVNSTKECRDLSRTDTTITCTMPGVEITTTVRVCVQF
ENKSCISDNCTFTYEKNPVITNISPQKSQVSGGRIITVEGNGFLMAQNVSMVVPAIGKEQ
TNCKVHTDTVITCPSPAASNITMGSKPAPVDFYINGRLYAEDSLFPLEHPEDAIHISKFH
LEYYADPQFFTAKKEKWIKHHPGEPLTLVIHKEPDNLGLESNEYEVKIGLISCEIQIVSD
KVIHCSVNESFSTSKRQLPVTIQVGKFIQTIAMLHLGGSEMAITVSIVICSILLLLSIVA
LFVFCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFL
EYKYFVTRTFFPKCSSLYEERYILPSQHLYSQMGSQIQETHPLLLGEWKIPENCRPNMEE
GIALFSTLLNNKHFLIVFVHALEQQKDFAVRDRCNLASLLTIALHGKLEYYTSIMKDLLV
DLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSFLKETVGEPFFLLLCAIKQQINKG
SIDAITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRVMDTDTLSQVKEKIL
EAFCKNIPYSQWPRVEDVDLEWFATSTDSYILRDLDDTSVMEDGRKKLNTLAHYKVPDGA
SLAMSLTDKKDTTLSRVKDLDTEKYFHLVLPTDELNENKKSHRQSHRKKVLPEIYLTRLL
STKGTLQKFLDDLFKAILSIREDKPPVAIKYFFDFLEEQSEKRGISDPDTLHIWKTNSLP
LRFWVNILKNPQFVFDIDKTDHIDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEI
PEYRKIVQRYYKQIHDMPPLSEQEMNAHLAEESRKCRNEFNTNVAMTEIYKYAKRYRNQI
VTALDSNPTTRRTQLQHKFEQVIALMEDNIYECCSEA
Download sequence
Identical sequences XP_015280719.1.55130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]