SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015282636.1.55130 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015282636.1.55130
Domain Number 1 Region: 257-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 537-593
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.41e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 481-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.62e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 313-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.78e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 5 Region: 593-649
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.81e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 369-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-22
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 7 Region: 428-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-20
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 8 Region: 634-686
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.89e-20
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 9 Region: 201-257
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.12e-19
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 10 Region: 158-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-18
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 11 Region: 29-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000379
Family KRAB domain (Kruppel-associated box) 0.0063
Further Details:      
 
Domain Number 12 Region: 113-152
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000976
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015282636.1.55130
Sequence length 695
Comment PREDICTED: zinc finger protein 883-like [Gekko japonicus]; AA=GCF_001447785.1; RF=representative genome; TAX=146911; STAX=146911; NAME=Gekko japonicus; AL=Scaffold; RT=Major
Sequence
MGGGQAGELFSPAGREKCGYSVFVDGELGPFSFEEVAAYFTGAEWVLLDLDQRALWDDGG
NEEDEELHHLSPDEVKSEDLRGKFRTQGRPKRQKGSHIVEKMDQPIPFQEGDFHEAIHMV
EELYKCTECGMIFSDETQYNVHLQMQSGKKTHEGLEIHRGEKPLECSECGKRFSLNSHLQ
LHQRIHRGEKPLECSECGKRFSHRHSLTKHLRIHTGEKPFECSECGKRLCDSSNFQRHLR
THTKAKLFDCSECGKKFNQSSHLQEHQRTHTGEKPFECSECGKRFSLSSNLHKHLRTHTG
EKPFECSECGKRFRLNDSFQLHQRTHTGEKPFACSECGKKFSQSGHLQQHLRTHTGEKPF
ECSECGKRFRESGSLLKHLQVHTGEKPFECSECGKSFSHRRSLTKHLRIHTGEKPFECSE
CGKQLCDSSNFQRHLRTHKKEKLFECSECGKKFNQSSHLQEHQRTHTGEKPFECSECGKK
FSLSSNLHKHLGTHTGEKPFECSECGKRFRLNDSLQLHQRTHTGEKPFECSECGKRFSQS
GHLQLHQRTHTGEKPFPCSECGKRFSDTGSLLKHVRVHTGEKPFECPECGKRFCSSSNFQ
RHLRTHTKEKPFHCSECGKSFSQSGHLQQHIRTHTGEKPFECSECGKRFSRSSNLQMHQR
IHTMENPFECSECGKRFILNDHLQNHQRTHRRRNI
Download sequence
Identical sequences XP_015282636.1.55130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]