SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015286129.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015286129.1.63531
Domain Number 1 Region: 51-345
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 5.91e-51
Family Galactosyltransferase LgtC 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015286129.1.63531
Sequence length 349
Comment PREDICTED: glycosyltransferase 8 domain-containing protein 2 isoform X1 [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MALLRKINQVLLFLLIVTLCVILYKKVHKGTVSKNDADDESETPEELEEEIPVVICAAAG
RMGATMAAINSIYSNTDANILFYVVGLRNTLTRIRKWIEHSKLREINFKIVEFNPMVLKG
KIRPDSSRPELLQPLNFVRFYLPLLIHQHEKVIYLDDDVIVQGDIQELYDTTLALGHAAA
FSDDCDLPSAQDINRLVGLQNTYMGYLDYRKKAIKDLGISPSTCSFNPGVIVANMTEWKH
QHITKQLEKWMQKNVEENLYSSSLGGGVATSPMLIVFHGKYSTINPLWHIRHLGWNPDAR
YSEHFLQEAKLLHWNGRHKPWDFPSVHNDLWESWFVPDPAGIFKLNHHS
Download sequence
Identical sequences A0A2K5TKM4 A0A2K6BUN7 F6V7I4
ENSMMUP00000028036 ENSMMUP00000028038 ENSMMUP00000028036 NP_001247473.1.72884 XP_005572113.1.63531 XP_005572115.1.63531 XP_011767331.1.29376 XP_011767332.1.29376 XP_011767333.1.29376 XP_011767335.1.29376 XP_015008027.1.72884 XP_015008028.1.72884 XP_015008029.1.72884 XP_015008030.1.72884 XP_015008031.1.72884 XP_015286129.1.63531 XP_015286130.1.63531 XP_015286131.1.63531 XP_015286132.1.63531 9544.ENSMMUP00000028036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]