SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015286134.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_015286134.1.63531
Domain Number - Region: 114-266
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.000206
Family Spore coat polysaccharide biosynthesis protein SpsA 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015286134.1.63531
Sequence length 478
Comment PREDICTED: alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C isoform X1 [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MFKFHQMKHIFEILDKMRCLRKRSTVSFLGVLVIFLLFMNLYIEDSYVLEGDKQLIRETS
THQLNSERYVHTFKDLSNFSGAINVTYRYLAATPLQRKRYLTIGLSSVKRKKGNYLLETI
KSIFEQSSYEELKEISVVVHLADFNSSWRDAMVQDITQKFAHHIIAGRLMVIHAPEEYYP
ILDGLKRNYNDPEDRVKFRSKQNVDYAFLLNFCANTSDYYVMLEDDVRCSKNFLTAIKKV
IASLEGTYWVTLEFSKLGYIGKLYHSHDLPRLAHFLLMFYQEMPCDWLLTHFRGLLAQKN
VIRFKPSLFQHMGYYSSYKGTENKLKDDDFEEESFDIPDNPPASLYTNMNVFENYEASKA
YSSVDEYFWGKPPSTGDVFVIVFENPIIIKKIKVNTGTEDRQNDILHHGALDVGENVMPS
KRRRQCSTYLRLGEFKNGNFEMSGVNQKIPFDIHCMRIYVTKTQKEWLIIRSISIWTS
Download sequence
Identical sequences A0A096NZ66 A0A0D9QV03 A0A2K5I5J2 A0A2K5ZDV4 A0A2K6L872 A0A2K6NJ90 F7DM72 Q4R4A8
9544.ENSMMUP00000030412 ENSMMUP00000030412 ENSMMUP00000030412 NP_001270014.1.63531 XP_001090411.1.72884 XP_002798744.1.72884 XP_002798745.1.72884 XP_008002373.1.81039 XP_008002374.1.81039 XP_010353830.1.97406 XP_010353831.1.97406 XP_010353832.1.97406 XP_011725263.1.29376 XP_011725265.1.29376 XP_011725266.1.29376 XP_011725267.1.29376 XP_011725268.1.29376 XP_011725269.1.29376 XP_011725270.1.29376 XP_011725271.1.29376 XP_011725272.1.29376 XP_011725273.1.29376 XP_011819341.1.43180 XP_011819342.1.43180 XP_011819343.1.43180 XP_011819344.1.43180 XP_011819345.1.43180 XP_011826783.1.47321 XP_011826785.1.47321 XP_011826786.1.47321 XP_015007865.1.72884 XP_015007866.1.72884 XP_015007867.1.72884 XP_015286134.1.63531 XP_015286135.1.63531 XP_015286136.1.63531 XP_015286137.1.63531 XP_015286138.1.63531 XP_015286139.1.63531 XP_017736198.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]