SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015288204.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015288204.1.63531
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 5.59e-46
Family D-ribulose-5-phosphate 3-epimerase 0.0000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015288204.1.63531
Sequence length 160
Comment PREDICTED: ribulose-phosphate 3-epimerase isoform X4 [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYL
APWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAE
AGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDR
Download sequence
Identical sequences A0A2J8N625 A0A2J8XSZ2
ENSP00000389411 ENSP00000402061 ENSP00000389411 ENSP00000402061 NP_001265215.1.87134 NP_001265215.1.92137 NP_001265217.1.87134 NP_001265217.1.92137 NP_001305859.1.87134 NP_001305859.1.92137 NP_001305860.1.87134 NP_001305860.1.92137 XP_005574216.1.63531 XP_006712740.1.92137 XP_007964316.1.81039 XP_007964317.1.81039 XP_008957245.1.60992 XP_008957246.1.60992 XP_008957247.1.60992 XP_009442464.1.37143 XP_009442466.1.37143 XP_009442467.1.37143 XP_010353233.1.97406 XP_010353234.1.97406 XP_011738761.1.29376 XP_011738762.1.29376 XP_011738763.1.29376 XP_011738764.1.29376 XP_011787727.1.43180 XP_011787728.1.43180 XP_011821928.1.47321 XP_011821929.1.47321 XP_011903201.1.92194 XP_011903202.1.92194 XP_011903203.1.92194 XP_011903204.1.92194 XP_011903205.1.92194 XP_012356716.1.23891 XP_012356720.1.23891 XP_014966353.1.72884 XP_014966355.1.72884 XP_014966356.1.72884 XP_015288202.1.63531 XP_015288204.1.63531 XP_017744853.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]