SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015293678.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015293678.1.63531
Domain Number 1 Region: 38-143
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.04e-16
Family Growth factor receptor domain 0.0019
Further Details:      
 
Domain Number 2 Region: 147-200
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000536
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015293678.1.63531
Sequence length 262
Comment PREDICTED: R-spondin-1 [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MRLGLCVVALVLSWTHLTIGSRGIKGKRQRRISVEGSQACAKGCELCSEVNGCLKCSPKL
FILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYL
HKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKKKLCGFRRGSEERTRRVL
NAPGGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGTGSR
RRKGQQQQQQGTVGPLTSAGPA
Download sequence
Identical sequences A0A1D5Q7L9 G7NUA4
ENSMMUP00000011037 XP_001112136.1.72884 XP_005543984.1.63531 XP_014991162.1.72884 XP_015293678.1.63531 9544.ENSMMUP00000011037 ENSMMUP00000011037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]