SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015295859.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015295859.1.63531
Domain Number 1 Region: 53-177
Classification Level Classification E-value
Superfamily POZ domain 3.19e-30
Family BTB/POZ domain 0.0016
Further Details:      
 
Domain Number 2 Region: 327-442
Classification Level Classification E-value
Superfamily Kelch motif 4.84e-30
Family Kelch motif 0.000000294
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015295859.1.63531
Sequence length 442
Comment PREDICTED: kelch-like ECH-associated protein 1 [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MQPDPKPSRAGACSRFLPLRSQCPEGSGDAVMYASTECKAEVTPSQHGNRTFSYTLEDHT
KQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGM
EVVSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLD
PSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAKQEEFFNLSHCQLVTLISRDDLNVR
CESEVFHACINWVKYDCEQRRFYVQALLRAVRCHSLTPNFLQMQLQKCEILQSDSRCKDY
LVKIFEELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQV
PRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGV
IDGHIYAVGGSHGCIHHNSVER
Download sequence
Identical sequences A0A2K5VM04
XP_005588006.1.63531 XP_015295859.1.63531 ENSMMUP00000006905 9544.ENSMMUP00000006905 ENSMMUP00000006905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]