SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015304237.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015304237.1.63531
Domain Number 1 Region: 12-71
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000663
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 151-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000307
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 60-113
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000542
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015304237.1.63531
Sequence length 463
Comment PREDICTED: zinc finger protein PLAGL1 isoform X1 [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MATFPCQLCGKTFLTLEKFTIHNYSHSRERPYKCVQPDCGKAFVSRYKLMRHMATHSPQK
SHQCAHCEKTFNRKDHLKNHLQTHDPNKMAFGCEECGKKYNTMLGYKRHLALHAASSGDL
TCGVCALELGSTEVLLDHLKSHAEEKPPSATKEKKHQCDHCERCFYTRKDVRRHLVVHTG
CKDFLCQFCAQRFGRKDHLTRHTKKTHSQELMKESLQTGDLLSTFHTISTSFQLKAAALP
PFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPESLASLHPSVSPSSPPPPLPN
HKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPQSPQKLNPGFDLAKGNAGKIN
LPKELPADAVNLTIPASLDLSPLLGFWQLPPPATQNTFGNSTLALGPGESLPHRLSCLGQ
QQQEPPLAMGTVSLGQLPLPPIPHVFSAGTGSAILPHFHHAFR
Download sequence
Identical sequences G7P511 I2CX74
ENSMMUP00000005001 ENSMMUP00000005002 NP_001247717.1.72884 XP_005552072.1.63531 XP_005552073.1.63531 XP_005552074.1.63531 XP_005552075.1.63531 XP_005552076.1.63531 XP_005552077.1.63531 XP_005552078.1.63531 XP_014992657.1.72884 XP_014992658.1.72884 XP_014992659.1.72884 XP_014992661.1.72884 XP_014992662.1.72884 XP_014992663.1.72884 XP_014992664.1.72884 XP_014992665.1.72884 XP_014992666.1.72884 XP_014992667.1.72884 XP_014992668.1.72884 XP_014992669.1.72884 XP_014992670.1.72884 XP_014992672.1.72884 XP_014992673.1.72884 XP_014992674.1.72884 XP_014992675.1.72884 XP_014992676.1.72884 XP_014992677.1.72884 XP_014992678.1.72884 XP_014992679.1.72884 XP_015304227.1.63531 XP_015304228.1.63531 XP_015304229.1.63531 XP_015304230.1.63531 XP_015304231.1.63531 XP_015304233.1.63531 XP_015304234.1.63531 XP_015304235.1.63531 XP_015304236.1.63531 XP_015304237.1.63531 XP_015304238.1.63531 XP_015304239.1.63531 XP_015304240.1.63531 XP_015304241.1.63531 XP_015304242.1.63531 XP_015304243.1.63531 ENSMMUP00000005001 9544.ENSMMUP00000005001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]