SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015308670.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015308670.1.63531
Domain Number 1 Region: 1117-1194
Classification Level Classification E-value
Superfamily Immunoglobulin 1.55e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 731-804
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000923
Family I set domains 0.049
Further Details:      
 
Domain Number 3 Region: 514-567
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000353
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 4 Region: 1012-1092
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000255
Family I set domains 0.034
Further Details:      
 
Domain Number 5 Region: 227-287
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000051
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 379-433
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 7 Region: 282-342
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 8 Region: 1234-1291
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.0069
Further Details:      
 
Domain Number 9 Region: 1295-1352
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000392
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 10 Region: 567-627
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000405
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 11 Region: 623-688
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000144
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 12 Region: 1408-1463
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000085
Family TSP-1 type 1 repeat 0.0059
Further Details:      
 
Domain Number 13 Region: 149-209
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000301
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 14 Region: 455-511
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000432
Family TSP-1 type 1 repeat 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015308670.1.63531
Sequence length 1500
Comment PREDICTED: ADAMTS-like protein 3 isoform X8 [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MCISGICQAVGCDRQLGSNAKEDNCGVCAGDGSTCRLVRGQSKSHVSPEKREENVIAVPL
GSRSVRITVKGPAHLFIESKTLQGSKGEHSFNSPGVFVVENTTVEFQRGSERQTFKIPGP
LMADFIFKTRYTAAKDSVVQFFFYQPISHQWRQTDFFPCTVTCGGGYQLNSAECVDIRLK
RVVPDHYCHYYPENVKPKPKLKECSMDPCPSSDGFKEIMPYDHFQPLPRWEHNPWTACSV
SCGGGIQRRSFVCVEESMHGEILQVEEWKCMYAPKPKVMQTCNLFDCPKWIAMEWSQCTV
TCGRGLRYRVVLCINHRGEHVGGCNPQLKLHIKEECVIPIPCYKPKEKSPVEAKLPWLKQ
AQELEETRIATEEPTFIPDPWSACSTTCGPGVQVREVKCRVLLTFTQTETELPEEECEGP
KLPTERPCLLEACDESLASRELDIPLPEDSEMTYDWEYAGFTPCTATCLGGHQEAIAVCL
HIQTQQTVNDSLCDMVHRPPAMSQACNTEPCPPRWHMGSWGPCSATCGVGIQTRDVYCLH
PGETPAPPEECRDEKPHALQACNQFDCPPGWHIEEWQQCSRTCGGGTQNRRVTCRQLLTD
GSFLNLSDELCQGPKASSHKSCARTDCPPHLAVGDWSKCSVSCGVGIQRRKQVCQRLTAK
GRLVPLSEMMCRDLPGLPLVRSCQTPECSKIKSEMKTKLGEQGPQILSVQRVYIQTREEK
RINLTIGSRAYLLPNTSVIIKCPVRRFQKSLIQWEKDGRCLQNSKRLGITKSGSLKIHSL
ATPDIGVYRCIAGSAQETVVLKLIGTDNRLIARPALREPMREYPGMDHNEANSLGVTWHK
MRQMWNNKNDLYLDDDYISNQPFLRALLGHCSSSAGNTNSWELKNKQFEAAVKQGAYSMD
TAQFDELIRNMSQLMETGEVSDDLASQLIYQLVAELAKAQPTHMQWWGIQEEMPPAAQLR
GETGSVSQSSNAKNSGKLTFKPKGPVLMRQSQPPSISFNKTINSRIGNTVYITKRTEVIN
ILCDLITPGEATYTWTKDGTLLQPSVKIILDGTGKIQIQNPTRKEQGIYECSVANHLGSD
VESSSVLYAEAPVILSIERNITKPEHNHLSVMVGGIVEAALGANVTIRCPVKGVPQPNIT
WLKRGGSLSGNVSLLFNGSLLLQNVSLENEGTYVCTATNALGKAVATSVLHLLERRWPES
KIVFPQGHKKYVLQATNTRTNSNDPTGEPLPQEPFWEPGNWSRCSATCGHLGARIQRPQC
VMANGQEVSEALCDHLQKPLAGFQPCNIRDCPARWFTSMWSQCSVSCGEGYHSRQVMCKQ
TKANGTVQVVSPRACAPKDRPLGRKPCFGHPCVQWEPGNQCPGRCMGHAVRMQQHHTACQ
HNGSDSNCDDRRRPALRRNCTSGACDVCWHAGPWKPCTAACGRGLQSRKVDCIHTRSCKP
VAERHCVQKKKPVSWRHCLGPSCDSTYTSQTSTNKGAASHVKRDKPLEGSRCCCEDKSRI
Download sequence
Identical sequences XP_015308670.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]