SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015309415.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015309415.1.63531
Domain Number 1 Region: 41-102
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000189
Family Complement control module/SCR domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015309415.1.63531
Sequence length 303
Comment PREDICTED: sushi domain-containing protein 6 [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MCHGRIAPKSTSVFAVASVGHGVFLPLVILCTLLGDGLASVCPLPPEPENGGYICHPRPC
RDPLTAGSVIEYLCAEGYMLKGDYKYLTCKNGEWKPAMEISCRLNEDKDTHTSLGVPTLS
IVASTASSVALILLLVVLFVLLQPKLKSFHHSRRDQGVSGDQVSIMVDGVQVALPSYEEA
VYGSSGHCVPPADPRVQIVLSEGSGPSGRSVSREQQPPDQGACSSAGGEDEAPGQSGLCE
VWGSRGSETVMVHQATTSSWVAGSGNRQLAHKEAADSENSDIQSLLSLTSEEYTDDIPLL
KEA
Download sequence
Identical sequences A0A096NVU4 A0A2K5L8Q8 A0A2K6AQ70 G7MYI9 G7PAR2
NP_001181376.1.72884 XP_005561668.1.63531 XP_011724786.1.29376 XP_011724787.1.29376 XP_011909329.1.92194 XP_011909330.1.92194 XP_014999424.1.72884 XP_015309415.1.63531 ENSMMUP00000020616 ENSPANP00000017169 9544.ENSMMUP00000020616 ENSMMUP00000020616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]