SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015310063.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015310063.1.63531
Domain Number 1 Region: 106-308
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.97e-52
Family Nuclear receptor ligand-binding domain 0.00000000578
Further Details:      
 
Domain Number 2 Region: 9-88
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.62e-28
Family Nuclear receptor 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015310063.1.63531
Sequence length 309
Comment PREDICTED: nuclear receptor subfamily 1 group I member 3 isoform X6 [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFAGSCEVSKIQR
RHCPACRLQKCLDAGMRKDMILSAEALALRRAKQAQRRAQQTPMQLSNEQEELIQTLLGA
HTRHMGTMFEQFVQFRPPAHLFIHHQPLPTLAPVLPLVTHFADVNTFMVQQVIKFTKDLP
VFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDAARDRPGVTQRH
EIDQLQEEMALTLQSYIKGQQQRPRDRFLYAKLLGLLAELRSINEAYGYQIQHIQGLSAM
MPLLQEICS
Download sequence
Identical sequences XP_011768475.1.29376 XP_015310063.1.63531 ENSMMUP00000023826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]