SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015315033.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015315033.1.76553
Domain Number 1 Region: 2121-2215
Classification Level Classification E-value
Superfamily C-type lectin-like 5.18e-31
Family Link domain 0.00016
Further Details:      
 
Domain Number 2 Region: 421-559
Classification Level Classification E-value
Superfamily FAS1 domain 1.7e-29
Family FAS1 domain 0.0018
Further Details:      
 
Domain Number 3 Region: 1385-1433,1511-1625
Classification Level Classification E-value
Superfamily FAS1 domain 3.4e-26
Family FAS1 domain 0.0026
Further Details:      
 
Domain Number 4 Region: 1626-1780
Classification Level Classification E-value
Superfamily FAS1 domain 1.7e-24
Family FAS1 domain 0.0052
Further Details:      
 
Domain Number 5 Region: 877-1034
Classification Level Classification E-value
Superfamily FAS1 domain 2.88e-23
Family FAS1 domain 0.0032
Further Details:      
 
Domain Number 6 Region: 300-413
Classification Level Classification E-value
Superfamily FAS1 domain 1.57e-19
Family FAS1 domain 0.0079
Further Details:      
 
Domain Number 7 Region: 2212-2375
Classification Level Classification E-value
Superfamily FAS1 domain 6.02e-17
Family FAS1 domain 0.008
Further Details:      
 
Domain Number 8 Region: 1043-1166
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000000667
Family FAS1 domain 0.0063
Further Details:      
 
Domain Number 9 Region: 1457-1494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000055
Family Merozoite surface protein 1 (MSP-1) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015315033.1.76553
Sequence length 2484
Comment PREDICTED: stabilin-1 isoform X2 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MSGCSLECWKDMVQKACCPGYWGSQCYECPGGAETPCSGHGTCLDGLDGNGTCVCQENFS
GSACQECRDPNRFGPDCQSVCRCVHGVCRHGPRGDGSCLCFAGYTGARCDQELLACQALN
CPRNSQCSEEAPSCSCLPGYTQQGHECRASDPCRPSPCSPLAQCSVGPGGQAQCRCPENY
HGDGTVCLPQDPCTTNNGGCPSNSTLCLYRKPGQASCLCKPGLVSIAHDSSAGCFAHCSA
FSCDRSATCQVTPDGKTSCVCKEGEVGDGRACYGHLLHEVQKASQTSMLLRLRVTFAMLD
QGCREILSTSGPFTVLAPLVSSRTMNASVAQQLCRQHIIAGQHMLEEAGTQAPRRWWTLA
GQEITVSFSRFRKYTYKYQDQPQQTFTIHKANYPAANGLFHVVTALRLQPPPELPEDPKR
TIGQILASNEVFSRFETILENCGLPSFLDGPGPFTVFAPSNEAVDGLRDGRLVYLFTAGL
SKLQELVRYHVYNHGQLTVEKLLSKGRVLTMANQILAVNISEEGRILLGPEGVPLRRVDV
LAANGVIHMLEGVLLPPTILPILPKLCNEEQHAVVAGSCVDCQALNTSTCPPNSVKLDIS
PEECVYIHDPTGLNVLKKGCAYYCNQTIQKPGCCKGFFGPDCLQCPGGFSNPCYGKGNCS
DGVQGSGACLCFPDYKGIACHICSNPNKHGDQCQEDCGCVHGLCDNRPGSGGVCQHGTCA
PGFSGRFCNESTVSCGSTEQAQQCHPHARCVNQGGVSRCLCLDGFEGDGFSCTPSDPCSR
PDRGGCSENAECVPGVRGAHHCMCHKGWSGDGRVCVAVDECELDLRGGCHADALCSYVGP
GQSRCTCKLGFAGDGYVCSPIDPCRAGNGGCHDLATCRAVGGGQRVCTCPPDYGGDGFSC
YGDILKELEANAHFSVFYQWIKGAGITLPADSQVTALVPSESAIRRLSTEDQAFWLQPRL
LPQLVRAHFLQGALSEEELARLHGQNVSTLNPTVRWEIHNVSGRVWVQNASVDVADLLAT
NGVLHVLSQVLLPPRRDVLGGQGLLQQLDSVPAFHLFRELLQRHRLVPQIEAATAYTIFV
PTNHSLEAQANSSSLDSDVVRHHVILGEALSTEALGKGGHRNSLLGPAHWLVFYNHSGQP
EVNHVPLEGPVLQAPGRSLFGLSGVLTVGSSRCLHSHAEALREKCVNCSRKFRCTQGYQL
EDTPRKSCVYRSGYSFSRGCSYTCAKKIQVPDCCPGFFGTLCEPCPGGLGGVCSGHGQCQ
DRLLGSGECRCHEGFHGTACEMCELGRYGPNCTGVCDCAHGLCQEGLRGDGSCVCNVGWQ
GLRCDQKISGPQCLQKCDPNANCVQDSAAAPVCVCAAGYSGDGVSCSAVDPCARDHGGCS
PHANCTTVAPGQRTCTCLDGYTGDGELCREANSCLIRHGGCHMHAECIPTGPQQVSCSCR
EGYSGDGIRACVLLDPCSQNNGGCSPYAVCKSTGDGQRTCACDAVRTVGDGFTCRARISL
ELLRDKHASFFSLHLLEYKDLKGDGPFTVFVPHADLLTNMSQDELARIRANRQLVFRYHV
VGCRQLRSQELLEEGYATALSGHPLRFSEREGNIYINDFARVVSSDQEAVNGVLHFIDRV
LLPPEVLHWEADAAPAPRRNFTAAAETFGYKIFSGLVTMAGLLPLLQDSSHRPLTMLWPT
DSALQALPPDRQVWLYHKDHRDKLAAILRGHVIRNVEALASDLPNLGPLRTMHGTPISFS
CSHARPGALTVGEDAARIVQRHLPFEGGLAYGIDQLLEPPGLGARCDRFETRPLWLKVCS
ICGLEPPCPPGSQEQGSPEACWRYFSKFWTSPPLHSLALRSVWTRPSHWGHPQGLGRGCY
RNCVTTTWKPSCCPGHYGSECRACPGGASSPCNQRGSCMDGMSGSGECRCHTRFAGTACE
LCAPGAFGPLCQACNCTSHGRCDEGLGGSGSCFCDEGWTGPRCEVQLELQPVCAPPCAPQ
AVCRAGNSCECSLGYEGDGRTCTVVNLCQDGRGGCSEHANCSQAGTAVTCICWPDYEGDG
WSCRARNPCEDGLRGGCSEHADCLNTGPNTRRCVCHAGYVGDGLQCLLEPEPPVDRCLDR
PPPCHADAVCTDLHFQEKRAGVFHLQAPSGPYGLNFSEAEAACGAQGAVLASLLQLSAAQ
QLGLHLCLVGWLANGSAAHPVVFPAADCGDGQVGVVSLGARENLSERWDAYCFRMRDVAC
RCRDGFVGDGTSVCNGKLLDVLATTANFSIFYGMLLGYANATPRGLEFLDFLDDERTYKT
LFVPVDEAFTDNTTLSGPDLELHASNTTFLSANASQGALLPAHSGLSLVIGNLGPGNSSR
APEVPGAVVVSRVIVWDILAFNGIIHTLASPLLAPPQAWAVVAPEAPPVAAGVGAVVAAG
AVLGLVAGALYFRGRSRSAGFGFSAFQAEDAAADDFSPWQEGTSPPLVSVPNPVFGSHEA
FCEPFDDSVLEEDFPDTQRILEVK
Download sequence
Identical sequences XP_015315031.1.76553 XP_015315033.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]