SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015323276.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015323276.1.59421
Domain Number 1 Region: 96-155
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000605
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 142-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000003
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015323276.1.59421
Sequence length 198
Comment PREDICTED: zinc finger protein 581 [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MLVLPAPGPRPPAFPSAEAMQAPPPRTGGSPEPGPSCSTGCPQTSPSSSRPNHYLLIDTQ
GVPYTVLVDEESQRESGPDGASAQKKCYSCPVCSRVFEYMSYLQRHSITHSEVKPFECDT
CGKAFKRASHLARHHSIHRAGGGRPHGCPLCPRRFREAGELAQHSRVHSGERPYQCPHCP
RRFMEQNTLQKHTRWKHP
Download sequence
Identical sequences G3N0P3
ENSBTAP00000055409 XP_010813805.1.76553 XP_012019080.1.54773 XP_015323276.1.59421 XP_017918535.1.57651 XP_019835649.1.53367 ENSBTAP00000055409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]