SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015324201.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015324201.1.59421
Domain Number 1 Region: 115-457
Classification Level Classification E-value
Superfamily L domain-like 6.8e-62
Family Internalin LRR domain 0.04
Further Details:      
 
Domain Number 2 Region: 687-782
Classification Level Classification E-value
Superfamily Immunoglobulin 1.49e-23
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 600-696
Classification Level Classification E-value
Superfamily Immunoglobulin 1.76e-22
Family I set domains 0.01
Further Details:      
 
Domain Number 4 Region: 495-605
Classification Level Classification E-value
Superfamily Immunoglobulin 1.42e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 5 Region: 44-131
Classification Level Classification E-value
Superfamily L domain-like 0.000000000000357
Family Ngr ectodomain-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015324201.1.59421
Sequence length 1090
Comment PREDICTED: leucine-rich repeats and immunoglobulin-like domains protein 1 [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MARPVRGALGAPRRSPCLLLLWLLLLLQLEPASATAGPRAPCAAACTCAGDYLDCGGRGL
AALPGDLPAWTRSLNLSYNKLSEIDPAGFEDLPNLQEVYLNNNELTAIPSLGSASSHIVS
LFLQHNRIRSVEGRQLKAYLSLHVLDLSANNITEIRSTCFPHGLPLTELNLASNRISTLE
SGAFDGLSRSLLTLRLSKNRITQLPVKAFKLPRLTQLDLNRNRIRLIEGLTFQGLDSLEV
LRLQRNNISKLTDGAFWGLARMHALHLEYNSLAEVNSGSLYGLTALHQLHLGNNSISRIH
RDGWSFCQKLHELILSFNNLTRLDEESLADLSSLSILRLSHNSISHIAEGAFRGLKSLRV
LDLDHNEISGTIEDTSGAFTGLDSLSKLTLFGNKIKSVAKRAFSGLEGLEHLNLGENAIR
SVQFDAFVKMKNLKELHISSDSFLCDCQLKWLPPWLLGRTLQSFVTATCAHPEALKGQSI
FSVPPESFVCDDLPKPQIITQPETITAVVGKDVRFTCSAASSSSSPMTFAWKKDNEALAN
ADMENFAHVRAQDGEVMEYTTVLHLRRLSFEHEGRYQCVITNHFGSSYSHKAKLTVHVFP
SFTKMPHDIAIRTGTTARLECAATGHPNPQIAWQKDGGTDFPAARERRMHVMPDDDVFFI
TDVKIGDMGVYSCTAQNSAGSVSANATLTVLETPSLAVPLEDRVVSVGETVALQCKAAGS
PPPRITWLKGDRPLSLTERHHFTPGNQLLVVQNVVLEDAGRYTCEMSNALGTERAHSQLS
VLPTPGCRKDGTTVGIFTIAVVCSIVLTSLVWVCIIYQTRKKSEEYSVTNTDETIVPPDV
PSYLSSQGTLSDRQETMVRMEGGHQANGHLESNGVCPRDAGLFPEVEAHGVICRQPKFCV
GFTKEPWKVVEKADGPPGPQKTMERSGPVGCSDCSADAHAYSQEPACRLQPGDSRQPGTS
SSQEPSLSEHPHSALHPSRGPLYPSNHDRTRAALKRPAAPLDGKGASSWTLARLCEPDSL
DLQPSSVLTAGKPELADAASGSPDVPGEGQHLLLSNGHIPQACDSGSESTPLTGQSPGRR
STPLLFAPKS
Download sequence
Identical sequences F1MZV0
ENSBTAP00000030722 XP_002697008.1.76553 XP_015324201.1.59421 ENSBTAP00000030722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]